Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4831
Gene name	NME/NM23 nucleoside diphosphate kinase 2
Gene symbol	NME2
Synonyms (NCBI Gene)	NDKBNDPK-BNDPKBNM23-H2NM23BPUF
Chromosome	17
Chromosome location	17q21.33
Summary	Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of `A` (encoded by NME1) and `B` (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighb

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050036	hsa-miR-27a-3p	CLASH	23622248
MIRT048132	hsa-miR-197-3p	CLASH	23622248
MIRT046894	hsa-miR-221-3p	CLASH	23622248
MIRT046082	hsa-miR-125b-5p	CLASH	23622248
MIRT045749	hsa-miR-125a-5p	CLASH	23622248
MIRT038030	hsa-miR-423-5p	CLASH	23622248
MIRT037769	hsa-miR-450b-5p	CLASH	23622248
MIRT036383	hsa-miR-1229-3p	CLASH	23622248
MIRT052795	hsa-miR-3176	CLASH	23622248
MIRT472113	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT472112	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT472111	hsa-miR-4257	PAR-CLIP	23592263
MIRT472110	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT472109	hsa-miR-1292-3p	PAR-CLIP	23592263
MIRT472108	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT472107	hsa-miR-558	PAR-CLIP	23592263
MIRT472106	hsa-miR-4487	PAR-CLIP	23592263
MIRT472105	hsa-miR-1827	PAR-CLIP	23592263
MIRT472104	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT472103	hsa-miR-6086	PAR-CLIP	23592263
MIRT472102	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT472101	hsa-miR-3612	PAR-CLIP	23592263
MIRT472100	hsa-miR-650	PAR-CLIP	23592263
MIRT472098	hsa-miR-4792	PAR-CLIP	23592263
MIRT472099	hsa-miR-4710	PAR-CLIP	23592263
MIRT472097	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT735945	hsa-miR-100-3p	Immunoprecipitaion (IP)	31694930
MIRT472113	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT472112	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT472111	hsa-miR-4257	PAR-CLIP	23592263
MIRT472110	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT472109	hsa-miR-1292-3p	PAR-CLIP	23592263
MIRT472108	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT472107	hsa-miR-558	PAR-CLIP	23592263
MIRT472106	hsa-miR-4487	PAR-CLIP	23592263
MIRT472105	hsa-miR-1827	PAR-CLIP	23592263
MIRT472104	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT472103	hsa-miR-6086	PAR-CLIP	23592263
MIRT472102	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT472101	hsa-miR-3612	PAR-CLIP	23592263
MIRT472100	hsa-miR-650	PAR-CLIP	23592263
MIRT472098	hsa-miR-4792	PAR-CLIP	23592263
MIRT472099	hsa-miR-4710	PAR-CLIP	23592263
MIRT472097	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT1187546	hsa-miR-1	CLIP-seq
MIRT1187547	hsa-miR-186	CLIP-seq
MIRT1187548	hsa-miR-206	CLIP-seq
MIRT1187549	hsa-miR-224	CLIP-seq
MIRT1187550	hsa-miR-3152-5p	CLIP-seq
MIRT1187551	hsa-miR-3163	CLIP-seq
MIRT1187552	hsa-miR-3673	CLIP-seq
MIRT1187553	hsa-miR-4423-5p	CLIP-seq
MIRT1187554	hsa-miR-4709-3p	CLIP-seq
MIRT1187555	hsa-miR-613	CLIP-seq
MIRT1187556	hsa-miR-182	CLIP-seq
MIRT1187557	hsa-miR-2115	CLIP-seq
MIRT1187558	hsa-miR-4470	CLIP-seq
MIRT1187546	hsa-miR-1	CLIP-seq
MIRT2054299	hsa-miR-1252	CLIP-seq
MIRT1187556	hsa-miR-182	CLIP-seq
MIRT2054300	hsa-miR-198	CLIP-seq
MIRT1187548	hsa-miR-206	CLIP-seq
MIRT1187557	hsa-miR-2115	CLIP-seq
MIRT1187549	hsa-miR-224	CLIP-seq
MIRT1187550	hsa-miR-3152-5p	CLIP-seq
MIRT2054301	hsa-miR-329	CLIP-seq
MIRT2054302	hsa-miR-362-3p	CLIP-seq
MIRT2054303	hsa-miR-3657	CLIP-seq
MIRT1187552	hsa-miR-3673	CLIP-seq
MIRT1187553	hsa-miR-4423-5p	CLIP-seq
MIRT1187558	hsa-miR-4470	CLIP-seq
MIRT2054304	hsa-miR-4669	CLIP-seq
MIRT2054305	hsa-miR-4685-5p	CLIP-seq
MIRT1187554	hsa-miR-4709-3p	CLIP-seq
MIRT1187555	hsa-miR-613	CLIP-seq
MIRT1187546	hsa-miR-1	CLIP-seq
MIRT1187556	hsa-miR-182	CLIP-seq
MIRT1187547	hsa-miR-186	CLIP-seq
MIRT2054300	hsa-miR-198	CLIP-seq
MIRT1187548	hsa-miR-206	CLIP-seq
MIRT1187557	hsa-miR-2115	CLIP-seq
MIRT1187549	hsa-miR-224	CLIP-seq
MIRT1187550	hsa-miR-3152-5p	CLIP-seq
MIRT1187551	hsa-miR-3163	CLIP-seq
MIRT2054301	hsa-miR-329	CLIP-seq
MIRT2054302	hsa-miR-362-3p	CLIP-seq
MIRT2054303	hsa-miR-3657	CLIP-seq
MIRT1187552	hsa-miR-3673	CLIP-seq
MIRT1187553	hsa-miR-4423-5p	CLIP-seq
MIRT1187558	hsa-miR-4470	CLIP-seq
MIRT2054304	hsa-miR-4669	CLIP-seq
MIRT2054305	hsa-miR-4685-5p	CLIP-seq
MIRT1187554	hsa-miR-4709-3p	CLIP-seq
MIRT1187555	hsa-miR-613	CLIP-seq

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001216	Function	DNA-binding transcription activator activity	IDA	8392752
GO:0001726	Component	Ruffle	IDA	11919189
GO:0001726	Component	Ruffle	IEA
GO:0003677	Function	DNA binding	IDA	11121025, 19435876
GO:0003677	Function	DNA binding	IEA
GO:0004518	Function	Nuclease activity	IDA	19435876
GO:0004550	Function	Nucleoside diphosphate kinase activity	IBA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	1851158, 9488696, 16313181, 25679041
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0004673	Function	Protein histidine kinase activity	IDA	17157250
GO:0004673	Function	Protein histidine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11919189, 16169070, 17314099, 17532299, 21988832, 24970086, 27499296, 31980649, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	15703214, 17532299
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	IDA	11919189
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006183	Process	GTP biosynthetic process	ISS
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0007155	Process	Cell adhesion	TAS	11919189
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	11919189
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IDA	1851158, 25679041
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IEA
GO:0016301	Function	Kinase activity	IDA	8529641
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019003	Function	GDP binding	IMP	19435876
GO:0030027	Component	Lamellipodium	IDA	11919189
GO:0030027	Component	Lamellipodium	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	21988832, 33961781
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16862176
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IMP	16862176
GO:0045682	Process	Regulation of epidermis development	IMP	16862176
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	8392752
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19435876
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15703214
GO:0046042	Process	ITP biosynthetic process	IDA	1851158
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	16862176
GO:0051880	Function	G-quadruplex DNA binding	IDA	19033359, 19435876, 25679041
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 23533145
GO:0071944	Component	Cell periphery	IDA	11919189
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000144	Process	Positive regulation of DNA-templated transcription initiation	IDA	19033359, 19435876

MIM	HGNC	e!Ensembl
156491	7850	ENSG00000243678

P22392

Protein name

Nucleoside diphosphate kinase B (NDK B) (NDP kinase B) (EC 2.7.4.6) (C-myc purine-binding transcription factor PUF) (Histidine protein kinase NDKB) (EC 2.7.13.3) (nm23-H2)

Protein function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regul

PDB

1NSK , 1NUE , 3BBB , 3BBC , 3BBF , 7KPF , 8PIE , 8PYW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00334	NDK	5 → 139	Nucleoside diphosphate kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Ubiquitously expressed. {ECO:0000269|PubMed:16442775}.; TISSUE SPECIFICITY: [Isoform 3]: Ubiquitously expressed. {ECO:0000269|PubMed:16442775}.

Sequence

MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Sequence length

152

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors		Interconversion of nucleotide di- and triphosphates Neutrophil degranulation

NME2 (NME/NM23 nucleoside diphosphate kinase 2)