Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4830
Gene name	NME/NM23 nucleoside diphosphate kinase 1
Gene symbol	NME1
Synonyms (NCBI Gene)	AWDGAADNBNBSNDKANDPK-ANDPKANM23NM23-H1
Chromosome	17
Chromosome location	17q21.33
Summary	This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of `A` (encoded by this gene) and `B` (encoded by NME2) isoforms. Mutations in this

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments
MIRT1187500	hsa-miR-1193	CLIP-seq
MIRT1187501	hsa-miR-1245b-3p	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187505	hsa-miR-146a	CLIP-seq
MIRT1187506	hsa-miR-146b-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187508	hsa-miR-1913	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187511	hsa-miR-3173-3p	CLIP-seq
MIRT1187512	hsa-miR-3192	CLIP-seq
MIRT1187513	hsa-miR-324-3p	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187515	hsa-miR-346	CLIP-seq
MIRT1187516	hsa-miR-3607-3p	CLIP-seq
MIRT1187517	hsa-miR-3685	CLIP-seq
MIRT1187518	hsa-miR-3689a-3p	CLIP-seq
MIRT1187519	hsa-miR-3689c	CLIP-seq
MIRT1187520	hsa-miR-384	CLIP-seq
MIRT1187521	hsa-miR-3908	CLIP-seq
MIRT1187522	hsa-miR-3909	CLIP-seq
MIRT1187523	hsa-miR-4270	CLIP-seq
MIRT1187524	hsa-miR-4290	CLIP-seq
MIRT1187525	hsa-miR-4441	CLIP-seq
MIRT1187526	hsa-miR-4527	CLIP-seq
MIRT1187527	hsa-miR-4533	CLIP-seq
MIRT1187528	hsa-miR-4641	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187531	hsa-miR-4694-3p	CLIP-seq
MIRT1187532	hsa-miR-4728-3p	CLIP-seq
MIRT1187533	hsa-miR-4728-5p	CLIP-seq
MIRT1187534	hsa-miR-4731-5p	CLIP-seq
MIRT1187535	hsa-miR-4747-5p	CLIP-seq
MIRT1187536	hsa-miR-4764-5p	CLIP-seq
MIRT1187537	hsa-miR-4779	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187539	hsa-miR-542-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187505	hsa-miR-146a	CLIP-seq
MIRT1187506	hsa-miR-146b-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187508	hsa-miR-1913	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187511	hsa-miR-3173-3p	CLIP-seq
MIRT1187512	hsa-miR-3192	CLIP-seq
MIRT1187513	hsa-miR-324-3p	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187517	hsa-miR-3685	CLIP-seq
MIRT1187518	hsa-miR-3689a-3p	CLIP-seq
MIRT1187519	hsa-miR-3689c	CLIP-seq
MIRT1187520	hsa-miR-384	CLIP-seq
MIRT1187522	hsa-miR-3909	CLIP-seq
MIRT1187523	hsa-miR-4270	CLIP-seq
MIRT1187525	hsa-miR-4441	CLIP-seq
MIRT1187527	hsa-miR-4533	CLIP-seq
MIRT1187528	hsa-miR-4641	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187532	hsa-miR-4728-3p	CLIP-seq
MIRT1187533	hsa-miR-4728-5p	CLIP-seq
MIRT1187534	hsa-miR-4731-5p	CLIP-seq
MIRT1187535	hsa-miR-4747-5p	CLIP-seq
MIRT1187537	hsa-miR-4779	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187500	hsa-miR-1193	CLIP-seq
MIRT1187501	hsa-miR-1245b-3p	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187505	hsa-miR-146a	CLIP-seq
MIRT1187506	hsa-miR-146b-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187512	hsa-miR-3192	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187516	hsa-miR-3607-3p	CLIP-seq
MIRT1187518	hsa-miR-3689a-3p	CLIP-seq
MIRT1187519	hsa-miR-3689c	CLIP-seq
MIRT1187523	hsa-miR-4270	CLIP-seq
MIRT1187525	hsa-miR-4441	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187532	hsa-miR-4728-3p	CLIP-seq
MIRT1187533	hsa-miR-4728-5p	CLIP-seq
MIRT1187534	hsa-miR-4731-5p	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187539	hsa-miR-542-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187500	hsa-miR-1193	CLIP-seq
MIRT1187504	hsa-miR-141	CLIP-seq
MIRT1187509	hsa-miR-200a	CLIP-seq
MIRT1187539	hsa-miR-542-5p	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187510	hsa-miR-28-3p	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187516	hsa-miR-3607-3p	CLIP-seq
MIRT1187517	hsa-miR-3685	CLIP-seq
MIRT1187520	hsa-miR-384	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq
MIRT1187502	hsa-miR-1272	CLIP-seq
MIRT1187503	hsa-miR-1322	CLIP-seq
MIRT1187507	hsa-miR-1470	CLIP-seq
MIRT1187514	hsa-miR-335	CLIP-seq
MIRT1187529	hsa-miR-4667-3p	CLIP-seq
MIRT1187530	hsa-miR-4670-3p	CLIP-seq
MIRT1187538	hsa-miR-486-5p	CLIP-seq
MIRT1187540	hsa-miR-642a	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
STAT3	Activation	23583378
TP53	Unknown	12669312

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	11555662
GO:0003677	Function	DNA binding	IDA	14960567
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004520	Function	DNA endonuclease activity	IDA	11694515, 12628186, 16818237
GO:0004536	Function	DNA nuclease activity	IDA	11555662
GO:0004550	Function	Nucleoside diphosphate kinase activity	IBA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	1851158, 8810265, 9488696, 12972261, 16313181, 19956735, 23519676, 33903070
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0004673	Function	Protein histidine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	10602478, 11701125, 15684389, 16189514, 16818237, 17314099, 17906697, 17975005, 18470881, 19060904, 21653829, 21988832, 25416956, 27499296, 31515488, 31980649, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	2509941, 16313181, 16814409
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005737	Component	Cytoplasm	IDA	2509941
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005769	Component	Early endosome	IDA	37267906
GO:0005829	Component	Cytosol	IDA	16814409
GO:0005829	Component	Cytosol	TAS
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0006308	Process	DNA catabolic process	IDA	11694515, 14960567, 16313181
GO:0006309	Process	Apoptotic DNA fragmentation	IDA	12628186, 16818237
GO:0006720	Process	Isoprenoid metabolic process	IDA	10952986
GO:0006897	Process	Endocytosis	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007595	Process	Lactation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1851158
GO:0008296	Function	3'-5'-DNA exonuclease activity	IDA	14960567, 16313181
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009132	Process	Nucleoside diphosphate metabolic process	IDA	19956735, 23519676, 33903070
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IDA	8810265, 19956735, 23519676, 33903070
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IDA	8529641
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016776	Function	Phosphotransferase activity, phosphate group as acceptor	IDA	10952986
GO:0019003	Function	GDP binding	IDA	12972261
GO:0030154	Process	Cell differentiation	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0032587	Component	Ruffle membrane	IDA	16814409
GO:0034214	Process	Protein hexamerization	IDA	11835509
GO:0042304	Process	Regulation of fatty acid biosynthetic process	ISS
GO:0042802	Function	Identical protein binding	IPI	10602478, 16189514, 17314099, 25416956, 25502805, 25910212, 31515488, 32296183
GO:0042981	Process	Regulation of apoptotic process	TAS	16130169
GO:0043024	Function	Ribosomal small subunit binding	IPI	16814409
GO:0043531	Function	ADP binding	IDA	12972261, 16944299
GO:0046042	Process	ITP biosynthetic process	IDA	1851158
GO:0046356	Process	Acetyl-CoA catabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0047887	Function	Farnesyl diphosphate kinase activity	IDA	10952986
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	16862176
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0120225	Function	Coenzyme A binding	ISS
GO:0120226	Function	Succinyl-CoA binding	ISS
GO:1905502	Function	Acetyl-CoA binding	ISS

MIM	HGNC	e!Ensembl
156490	7849	ENSG00000239672

P15531

Protein name

Nucleoside diphosphate kinase A (NDK A) (NDP kinase A) (EC 2.7.4.6) (Granzyme A-activated DNase) (GAAD) (Metastasis inhibition factor nm23) (NM23-H1) (Tumor metastatic process-associated protein)

Protein function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate

PDB

1JXV , 1UCN , 2HVD , 2HVE , 3L7U , 4ENO , 5UI4 , 8OOV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00334	NDK	5 → 139	Nucleoside diphosphate kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression

Sequence

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Sequence length

152

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors		Interconversion of nucleotide di- and triphosphates

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (124)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	1325827, 9823779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Stimulate	15334673	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Follicular	Associate	25048347	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	29522283, 32795291, 7928630	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Stimulate	27222072	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Associate	17278192	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allan Herndon Dudley syndrome	Stimulate	9555115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	25311278, 30268934, 36142676	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Inhibit	8660103	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	39217320	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Associate	16891807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	30268934	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Stimulate	36293204	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Associate	7593131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Inhibit	15592684, 8641989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	10082974, 1356959, 15592684, 15684389, 1714241, 17591363, 18676749, 21738817, 21838876, 22290468, 22451184, 23818346, 29203642, 31839604, 33402463 View all (6 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	11694515, 12163590, 16415009, 16631833, 17695492, 25048347, 28991262, 33436746, 8394105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	12515726	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Inhibit	16415009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	11337376, 15592684, 18661008, 19414372, 7981081	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Inhibit	12163590	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	12801264, 17359290, 32795291, 9569056	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Associate	1714241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Associate	1714241, 23725501	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	15761980, 20841469, 25472720, 29271183, 35438846	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Associate	20841469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Inhibit	1714241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	10733773, 11267948, 11896068, 19152459	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	10817501, 12950146, 7669582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	20515575, 7614395, 8593205, 9341897	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	17359290	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Associate	36430274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Intraventricular Hemorrhage	Associate	36430274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	29271183	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Associate	7593131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Associate	20841469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	15563674, 16425351, 20841469, 7981087	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	10450731, 15334673, 15563674, 16554912, 17278192, 19125701, 21225146, 23679306, 27888614, 29700912, 7947079, 7947085, 7981087, 8217591, 8549951	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Stimulate	27222072	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Digestive System Neoplasms	Associate	18810774	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	30827726, 8855975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	24133580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epstein Barr Virus Infections	Associate	16415009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	17708612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	10507772, 11027435, 11319942	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	36293204, 36430274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Stimulate	36768287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Associate	16814409	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Associate	19152459	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Associate	19152459	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Inhibit	16475705	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	17057884, 33721446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Stimulate	10910925, 16232196	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	8855975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary leiomyomatosis and renal cell cancer	Associate	18647967	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	18647967, 8956779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Associate	15228429	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopharyngeal Neoplasms	Associate	9555115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis prematurity syndrome	Associate	36768287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	7614395	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	9555115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngitis	Associate	9555115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	10910925, 1311721, 7612661	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Monocytic Acute	Associate	9490665	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	9490665	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Inhibit	9490665	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	10910925, 1311721, 33284559, 9490665, 9649149	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Associate	30448004	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Associate	20841469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	10450731	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	29970055, 32795291, 7928630	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	15040016, 15150613, 15334673, 16425351, 16554912, 22903495, 23679306, 23725501, 24858271, 32795291, 7669582, 7903963, 7981081, 8924224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Inhibit	17504447, 18810774, 29187211	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	14616965, 28991262, 8956779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Stimulate	18647967	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	14616965, 16891807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Stimulate	8956779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Peripheral	Associate	14616965	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Associate	39251709	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Inhibit	11694515, 28991262, 8394105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	19152459, 25048347, 25808322, 30396920, 31462745, 32824412, 7981081, 8648172, 8855975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Associate	19662092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Stimulate	34876614	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	10910925	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	22451184	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	10450731, 10507772, 10631462, 11267948, 12628186, 1311721, 14960567, 15040016, 16425351, 16475705, 16537673, 17278192, 18676749, 20713695, 22451184 View all (14 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	11337376, 11694515, 11896068, 12105213, 12192599, 12490715, 14998490, 15181008, 15563674, 15592684, 15650182, 15684389, 16140886, 16277028, 16415009 View all (44 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Seeding	Associate	18408655	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10428867, 10817501, 11027435, 11121025, 11208341, 11267948, 11896068, 12950146, 1311721, 14998490, 15040016, 15150613, 15228429, 15650182, 15785755 View all (44 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	11337376, 15563674, 16277028, 17532757, 18810774, 20841469, 24811176, 28376369, 30396920, 33436746, 7734302, 8549951, 8648172, 9443089	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	31462745	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Associate	7669582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Associate	36430274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	10400630, 16232196, 16442775, 17155928, 19186179, 2056128, 21573212, 22328561, 28991262, 8932344, 9038158, 9188446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Associate	19414372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	36430274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non Muscle Invasive Bladder Neoplasms	Associate	19171060, 8104920	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	7593131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	19152459	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	10631462, 10817501, 12950146, 17433065, 18408655, 19152459, 19487548, 21469425, 7669582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Associate	12950146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prodromal Symptoms	Associate	10733773, 29700912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Associate	7693635	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	24858271	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	19152459, 7693635	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	9099969	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Associate	21270158	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Inhibit	8389529	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	10219898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	11337376, 15150613, 25277180, 29187211, 35655921	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Intraepithelial Lesions	Associate	12801264	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	15040016, 16425351, 17504447, 17532757, 17695492, 20205286, 22799386, 22903495, 23725501, 37402315, 7902105, 8096503, 8641989, 8924224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Inhibit	16277028, 23012578, 8641989, 8855975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	16425351, 33402463	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Associate	12049674	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Inhibit	8389529	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Associate	8394105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	25048347, 8030752, 8394105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	19171060, 7614395	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Inhibit	16537673	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	16537673, 17359290, 26716410, 8855975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Associate	9823779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Associate	8855975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Associate	34782661	★★★★★ ★☆☆☆☆ Found in Text Mining only

NME1 (NME/NM23 nucleoside diphosphate kinase 1)