Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	4825
Gene name	NK6 homeobox 1
Gene symbol	NKX6-1
Synonyms (NCBI Gene)	NKX6.1NKX6A
Chromosome	4
Chromosome location	4q21.23
Summary	In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM, M

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048171	hsa-miR-196a-5p	CLASH	23622248
MIRT444278	hsa-miR-9500	PAR-CLIP	22100165
MIRT444277	hsa-miR-4785	PAR-CLIP	22100165
MIRT444276	hsa-miR-4747-5p	PAR-CLIP	22100165
MIRT444275	hsa-miR-5196-5p	PAR-CLIP	22100165
MIRT444274	hsa-miR-644a	PAR-CLIP	22100165
MIRT444273	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT444272	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT444271	hsa-miR-4474-3p	PAR-CLIP	22100165
MIRT444270	hsa-miR-8081	PAR-CLIP	22100165
MIRT440106	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT440106	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT444278	hsa-miR-9500	PAR-CLIP	22100165
MIRT444277	hsa-miR-4785	PAR-CLIP	22100165
MIRT444276	hsa-miR-4747-5p	PAR-CLIP	22100165
MIRT444275	hsa-miR-5196-5p	PAR-CLIP	22100165
MIRT444274	hsa-miR-644a	PAR-CLIP	22100165
MIRT444273	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT444272	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT444271	hsa-miR-4474-3p	PAR-CLIP	22100165
MIRT444270	hsa-miR-8081	PAR-CLIP	22100165

Show/Hide all (1)

Transcription factor	Regulation	Reference
FOXO1	Unknown	20033803

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0003309	Process	Type B pancreatic cell differentiation	IEA
GO:0003310	Process	Pancreatic A cell differentiation	IEA
GO:0003323	Process	Type B pancreatic cell development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009887	Process	Animal organ morphogenesis	TAS	10567713
GO:0010255	Process	Glucose mediated signaling pathway	ISS
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0022008	Process	Neurogenesis	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030516	Process	Regulation of axon extension	IEA
GO:0031016	Process	Pancreas development	ISS
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	ISS
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0072560	Process	Type B pancreatic cell maturation	ISS
GO:2000078	Process	Positive regulation of type B pancreatic cell development	ISS
GO:2001222	Process	Regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
602563	7839	ENSG00000163623

P78426

Protein name

Homeobox protein Nkx-6.1 (Homeobox protein NK-6 homolog A)

Protein function

Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in the development of insulin-producing beta cells in the islets of Langerhans at the secondary transition (By similarity)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	237 → 293	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Pancreatic beta cells.

Sequence

MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSSSSSSSSSSSP
SPPLGTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASP
SGSSSSSSSSASASSASAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSPS
AAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTR
PTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMA
TAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSSGGGGGLLLHA
SEPESSS

Sequence length

367

Interactions

View interactions

	KEGG
	Maturity onset diabetes of the young

NKX6-1 (NK6 homeobox 1)