Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4824
Gene name Gene Name - the full gene name approved by the HGNC.	NK3 homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NKX3-1
Synonyms (NCBI Gene) Gene synonyms aliases	BAPX2, NKX3, NKX3.1, NKX3A
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alterna

Show/Hide all(184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020697	hsa-miR-155-5p	Other	20584899
MIRT024883	hsa-miR-215-5p	Microarray	19074876
MIRT026366	hsa-miR-192-5p	Microarray	19074876
MIRT049849	hsa-miR-92a-3p	CLASH	23622248
MIRT731776	hsa-miR-378b	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26313654
MIRT731776	hsa-miR-378b	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26313654
MIRT731776	hsa-miR-378b	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26313654
MIRT731776	hsa-miR-378b	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26313654
MIRT1186557	hsa-miR-1224-3p	CLIP-seq
MIRT1186558	hsa-miR-1225-3p	CLIP-seq
MIRT1186559	hsa-miR-1233	CLIP-seq
MIRT1186560	hsa-miR-1256	CLIP-seq
MIRT1186561	hsa-miR-1260	CLIP-seq
MIRT1186562	hsa-miR-1260b	CLIP-seq
MIRT1186563	hsa-miR-1270	CLIP-seq
MIRT1186564	hsa-miR-1280	CLIP-seq
MIRT1186565	hsa-miR-129-5p	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186567	hsa-miR-15a	CLIP-seq
MIRT1186568	hsa-miR-15b	CLIP-seq
MIRT1186569	hsa-miR-16	CLIP-seq
MIRT1186570	hsa-miR-185	CLIP-seq
MIRT1186571	hsa-miR-195	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT1186573	hsa-miR-199a-3p	CLIP-seq
MIRT1186574	hsa-miR-199b-3p	CLIP-seq
MIRT1186575	hsa-miR-2117	CLIP-seq
MIRT1186576	hsa-miR-214	CLIP-seq
MIRT1186577	hsa-miR-3129-5p	CLIP-seq
MIRT1186578	hsa-miR-3175	CLIP-seq
MIRT1186579	hsa-miR-3199	CLIP-seq
MIRT1186580	hsa-miR-3616-3p	CLIP-seq
MIRT1186581	hsa-miR-3619-5p	CLIP-seq
MIRT1186582	hsa-miR-3663-3p	CLIP-seq
MIRT1186583	hsa-miR-424	CLIP-seq
MIRT1186584	hsa-miR-4257	CLIP-seq
MIRT1186585	hsa-miR-4290	CLIP-seq
MIRT1186586	hsa-miR-4291	CLIP-seq
MIRT1186587	hsa-miR-4306	CLIP-seq
MIRT1186588	hsa-miR-432	CLIP-seq
MIRT1186589	hsa-miR-450b-5p	CLIP-seq
MIRT1186590	hsa-miR-4531	CLIP-seq
MIRT1186591	hsa-miR-4644	CLIP-seq
MIRT1186592	hsa-miR-4687-5p	CLIP-seq
MIRT1186593	hsa-miR-4721	CLIP-seq
MIRT1186594	hsa-miR-4740-5p	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT1186596	hsa-miR-4753-3p	CLIP-seq
MIRT1186597	hsa-miR-4779	CLIP-seq
MIRT1186598	hsa-miR-4797-3p	CLIP-seq
MIRT1186599	hsa-miR-497	CLIP-seq
MIRT1186600	hsa-miR-507	CLIP-seq
MIRT1186601	hsa-miR-510	CLIP-seq
MIRT1186602	hsa-miR-512-5p	CLIP-seq
MIRT1186603	hsa-miR-557	CLIP-seq
MIRT1186604	hsa-miR-620	CLIP-seq
MIRT1186605	hsa-miR-761	CLIP-seq
MIRT1186606	hsa-miR-922	CLIP-seq
MIRT1186607	hsa-miR-936	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186567	hsa-miR-15a	CLIP-seq
MIRT1186568	hsa-miR-15b	CLIP-seq
MIRT1186569	hsa-miR-16	CLIP-seq
MIRT1186571	hsa-miR-195	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT2054073	hsa-miR-3127-3p	CLIP-seq
MIRT2054074	hsa-miR-3183	CLIP-seq
MIRT2054075	hsa-miR-328	CLIP-seq
MIRT2054076	hsa-miR-3911	CLIP-seq
MIRT2054077	hsa-miR-3921	CLIP-seq
MIRT1186583	hsa-miR-424	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2054079	hsa-miR-4302	CLIP-seq
MIRT2054080	hsa-miR-4446-5p	CLIP-seq
MIRT2054081	hsa-miR-4519	CLIP-seq
MIRT2054082	hsa-miR-4653-5p	CLIP-seq
MIRT2054083	hsa-miR-4723-3p	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT2054084	hsa-miR-4755-5p	CLIP-seq
MIRT2054085	hsa-miR-4768-5p	CLIP-seq
MIRT1186599	hsa-miR-497	CLIP-seq
MIRT2054086	hsa-miR-511	CLIP-seq
MIRT2054087	hsa-miR-642a	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT2283223	hsa-miR-3920	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2283224	hsa-miR-4491	CLIP-seq
MIRT2283225	hsa-miR-4496	CLIP-seq
MIRT2283226	hsa-miR-4657	CLIP-seq
MIRT2283227	hsa-miR-4668-3p	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT2283228	hsa-miR-4762-3p	CLIP-seq
MIRT2283229	hsa-miR-4777-3p	CLIP-seq
MIRT2283230	hsa-miR-4789-5p	CLIP-seq
MIRT2283231	hsa-miR-508-5p	CLIP-seq
MIRT2054086	hsa-miR-511	CLIP-seq
MIRT2283232	hsa-miR-518a-5p	CLIP-seq
MIRT2283233	hsa-miR-527	CLIP-seq
MIRT2283234	hsa-miR-665	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT2455237	hsa-miR-3613-3p	CLIP-seq
MIRT2455238	hsa-miR-376c	CLIP-seq
MIRT2455239	hsa-miR-4684-3p	CLIP-seq
MIRT2455240	hsa-miR-4781-3p	CLIP-seq
MIRT2455241	hsa-miR-4789-3p	CLIP-seq
MIRT2283232	hsa-miR-518a-5p	CLIP-seq
MIRT2283233	hsa-miR-527	CLIP-seq
MIRT2581486	hsa-miR-10a	CLIP-seq
MIRT2581487	hsa-miR-10b	CLIP-seq
MIRT2581488	hsa-miR-1229	CLIP-seq
MIRT2581489	hsa-miR-1276	CLIP-seq
MIRT2581490	hsa-miR-1278	CLIP-seq
MIRT2581491	hsa-miR-1291	CLIP-seq
MIRT2581492	hsa-miR-154	CLIP-seq
MIRT2581493	hsa-miR-191	CLIP-seq
MIRT2581494	hsa-miR-2110	CLIP-seq
MIRT2581495	hsa-miR-2113	CLIP-seq
MIRT2581496	hsa-miR-218	CLIP-seq
MIRT2581497	hsa-miR-2278	CLIP-seq
MIRT2581498	hsa-miR-3121-5p	CLIP-seq
MIRT2581499	hsa-miR-3144-5p	CLIP-seq
MIRT2581500	hsa-miR-3150a-3p	CLIP-seq
MIRT2581501	hsa-miR-3155	CLIP-seq
MIRT2581502	hsa-miR-3155b	CLIP-seq
MIRT2581503	hsa-miR-3191	CLIP-seq
MIRT2581504	hsa-miR-320e	CLIP-seq
MIRT2054075	hsa-miR-328	CLIP-seq
MIRT2581505	hsa-miR-3647-3p	CLIP-seq
MIRT2054077	hsa-miR-3921	CLIP-seq
MIRT2581506	hsa-miR-409-5p	CLIP-seq
MIRT2581507	hsa-miR-4260	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2581508	hsa-miR-4311	CLIP-seq
MIRT2581509	hsa-miR-4468	CLIP-seq
MIRT2581510	hsa-miR-4495	CLIP-seq
MIRT2581511	hsa-miR-4528	CLIP-seq
MIRT2581512	hsa-miR-4652-5p	CLIP-seq
MIRT2054082	hsa-miR-4653-5p	CLIP-seq
MIRT2581513	hsa-miR-4709-5p	CLIP-seq
MIRT2581514	hsa-miR-4715-3p	CLIP-seq
MIRT2581515	hsa-miR-4747-5p	CLIP-seq
MIRT2054085	hsa-miR-4768-5p	CLIP-seq
MIRT2581516	hsa-miR-4794	CLIP-seq
MIRT2581517	hsa-miR-484	CLIP-seq
MIRT2581518	hsa-miR-488	CLIP-seq
MIRT2581519	hsa-miR-553	CLIP-seq
MIRT2581520	hsa-miR-576-5p	CLIP-seq
MIRT2581521	hsa-miR-583	CLIP-seq
MIRT2581522	hsa-miR-660	CLIP-seq
MIRT2581523	hsa-miR-711	CLIP-seq
MIRT2581524	hsa-miR-767-3p	CLIP-seq
MIRT2581486	hsa-miR-10a	CLIP-seq
MIRT2581487	hsa-miR-10b	CLIP-seq
MIRT2581489	hsa-miR-1276	CLIP-seq
MIRT2581491	hsa-miR-1291	CLIP-seq
MIRT2581492	hsa-miR-154	CLIP-seq
MIRT2581495	hsa-miR-2113	CLIP-seq
MIRT2581497	hsa-miR-2278	CLIP-seq
MIRT2581498	hsa-miR-3121-5p	CLIP-seq
MIRT2581501	hsa-miR-3155	CLIP-seq
MIRT2581502	hsa-miR-3155b	CLIP-seq
MIRT2581504	hsa-miR-320e	CLIP-seq
MIRT2054075	hsa-miR-328	CLIP-seq
MIRT2054077	hsa-miR-3921	CLIP-seq
MIRT2581506	hsa-miR-409-5p	CLIP-seq
MIRT2581507	hsa-miR-4260	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2581508	hsa-miR-4311	CLIP-seq
MIRT2581509	hsa-miR-4468	CLIP-seq
MIRT2581510	hsa-miR-4495	CLIP-seq
MIRT2054082	hsa-miR-4653-5p	CLIP-seq
MIRT2581513	hsa-miR-4709-5p	CLIP-seq
MIRT2581514	hsa-miR-4715-3p	CLIP-seq
MIRT2054085	hsa-miR-4768-5p	CLIP-seq
MIRT2686380	hsa-miR-4790-3p	CLIP-seq
MIRT2581517	hsa-miR-484	CLIP-seq
MIRT2581520	hsa-miR-576-5p	CLIP-seq
MIRT2581521	hsa-miR-583	CLIP-seq
MIRT2581522	hsa-miR-660	CLIP-seq
MIRT2581524	hsa-miR-767-3p	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
AR	Activation	16697957;17303007
AR	Unknown	11238180
ETS1	Activation	20842667
MSX2	Activation	22848398
PITX1	Repression	21425961
SOX4	Unknown	20019190
TP53	Repression	17202838

Show/Hide all(77)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	19263243, 20855495
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18974119
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001656	Process	Metanephros development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	20395202
GO:0003700	Function	DNA-binding transcription factor activity	IDA	20855495
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11137288
GO:0004879	Function	Nuclear receptor activity	IDA	19886863
GO:0005515	Function	Protein binding	IPI	17234752, 18077445, 18296735, 19797053, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IC	20855495
GO:0005634	Component	Nucleus	IDA	18757402, 19263243
GO:0005634	Component	Nucleus	NAS	11137288
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of transcription, DNA-templated	NAS	11137288
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	17486276, 19266349
GO:0007275	Process	Multicellular organism development	TAS	9537602
GO:0007431	Process	Salivary gland development	ISS
GO:0007507	Process	Heart development	IEA
GO:0008134	Function	Transcription factor binding	IPI	20716579
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18360715
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	17486276, 19266349
GO:0008584	Process	Male gonad development	IEA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	19266349
GO:0010628	Process	Positive regulation of gene expression	IDA	17486276, 20599703
GO:0010628	Process	Positive regulation of gene expression	IMP	20716579
GO:0010629	Process	Negative regulation of gene expression	IDA	17486276
GO:0010942	Process	Positive regulation of cell death	IDA	19266349
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IDA	20395202
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030284	Function	Estrogen receptor activity	IDA	18794125
GO:0030331	Function	Estrogen receptor binding	IDA	18794125
GO:0030521	Process	Androgen receptor signaling pathway	IDA	19886863
GO:0032880	Process	Regulation of protein localization	IMP	20395202
GO:0033574	Process	Response to testosterone	ISS
GO:0035690	Process	Cellular response to drug	IEP	18757402
GO:0035907	Process	Dorsal aorta development	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	18974119
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	20599703
GO:0043491	Process	Protein kinase B signaling	IMP	19597465
GO:0043565	Function	Sequence-specific DNA binding	IDA	19780584
GO:0043569	Process	Negative regulation of insulin-like growth factor receptor signaling pathway	ISS
GO:0043621	Function	Protein self-association	IDA	19780584
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	18794125, 19597465
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IMP	18360715, 18974119
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	18360715
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045930	Process	Negative regulation of mitotic cell cycle	IDA	19266349
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	20855495
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19797053, 20855495
GO:0048754	Process	Branching morphogenesis of an epithelial tube	ISS
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IEA
GO:0051781	Process	Positive regulation of cell division	IMP	20855495
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060442	Process	Branching involved in prostate gland morphogenesis	ISS
GO:0060664	Process	Epithelial cell proliferation involved in salivary gland morphogenesis	ISS
GO:0060770	Process	Negative regulation of epithelial cell proliferation involved in prostate gland development	ISS
GO:0071347	Process	Cellular response to interleukin-1	IEP	18757402
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	18757402
GO:0071383	Process	Cellular response to steroid hormone stimulus	IDA	19886863
GO:0071456	Process	Cellular response to hypoxia	IDA	21056661
GO:0071850	Process	Mitotic cell cycle arrest	IDA	19266349
GO:0071899	Process	Negative regulation of estrogen receptor binding	IDA	18794125
GO:0090734	Component	Site of DNA damage	IDA	20395202
GO:0097162	Function	MADS box domain binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000836	Process	Positive regulation of androgen secretion	IDA	19886863
GO:2001022	Process	Positive regulation of response to DNA damage stimulus	IDA	20395202
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	20599703
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IDA	17486276

MIM	HGNC	e!Ensembl
602041	7838	ENSG00000167034

Protein

UniProt ID

Q99801

Protein name

Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)

Protein function

Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and i

PDB

2L9R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	125 → 181	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the prostate and, at a lower level, in the testis. {ECO:0000269|PubMed:9226374, ECO:0000269|PubMed:9537602}.

Sequence

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP
EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP
KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK
RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW

Sequence length

234

Interactions

View interactions

	KEGG
	Pathways in cancer Prostate cancer

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	16817226, 17202838, 22610119, 17173048

NKX3-1 (NK3 homeobox 1)