Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	4824
Gene name	NK3 homeobox 1
Gene symbol	NKX3-1
Synonyms (NCBI Gene)	BAPX2NKX3NKX3.1NKX3A
Chromosome	8
Chromosome location	8p21.2
Summary	This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alterna

184

Show/Hide all (184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020697	hsa-miR-155-5p	Other	20584899
MIRT024883	hsa-miR-215-5p	Microarray	19074876
MIRT026366	hsa-miR-192-5p	Microarray	19074876
MIRT049849	hsa-miR-92a-3p	CLASH	23622248
MIRT731776	hsa-miR-378b	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26313654
MIRT731776	hsa-miR-378b	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26313654
MIRT731776	hsa-miR-378b	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26313654
MIRT731776	hsa-miR-378b	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26313654
MIRT1186557	hsa-miR-1224-3p	CLIP-seq
MIRT1186558	hsa-miR-1225-3p	CLIP-seq
MIRT1186559	hsa-miR-1233	CLIP-seq
MIRT1186560	hsa-miR-1256	CLIP-seq
MIRT1186561	hsa-miR-1260	CLIP-seq
MIRT1186562	hsa-miR-1260b	CLIP-seq
MIRT1186563	hsa-miR-1270	CLIP-seq
MIRT1186564	hsa-miR-1280	CLIP-seq
MIRT1186565	hsa-miR-129-5p	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186567	hsa-miR-15a	CLIP-seq
MIRT1186568	hsa-miR-15b	CLIP-seq
MIRT1186569	hsa-miR-16	CLIP-seq
MIRT1186570	hsa-miR-185	CLIP-seq
MIRT1186571	hsa-miR-195	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT1186573	hsa-miR-199a-3p	CLIP-seq
MIRT1186574	hsa-miR-199b-3p	CLIP-seq
MIRT1186575	hsa-miR-2117	CLIP-seq
MIRT1186576	hsa-miR-214	CLIP-seq
MIRT1186577	hsa-miR-3129-5p	CLIP-seq
MIRT1186578	hsa-miR-3175	CLIP-seq
MIRT1186579	hsa-miR-3199	CLIP-seq
MIRT1186580	hsa-miR-3616-3p	CLIP-seq
MIRT1186581	hsa-miR-3619-5p	CLIP-seq
MIRT1186582	hsa-miR-3663-3p	CLIP-seq
MIRT1186583	hsa-miR-424	CLIP-seq
MIRT1186584	hsa-miR-4257	CLIP-seq
MIRT1186585	hsa-miR-4290	CLIP-seq
MIRT1186586	hsa-miR-4291	CLIP-seq
MIRT1186587	hsa-miR-4306	CLIP-seq
MIRT1186588	hsa-miR-432	CLIP-seq
MIRT1186589	hsa-miR-450b-5p	CLIP-seq
MIRT1186590	hsa-miR-4531	CLIP-seq
MIRT1186591	hsa-miR-4644	CLIP-seq
MIRT1186592	hsa-miR-4687-5p	CLIP-seq
MIRT1186593	hsa-miR-4721	CLIP-seq
MIRT1186594	hsa-miR-4740-5p	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT1186596	hsa-miR-4753-3p	CLIP-seq
MIRT1186597	hsa-miR-4779	CLIP-seq
MIRT1186598	hsa-miR-4797-3p	CLIP-seq
MIRT1186599	hsa-miR-497	CLIP-seq
MIRT1186600	hsa-miR-507	CLIP-seq
MIRT1186601	hsa-miR-510	CLIP-seq
MIRT1186602	hsa-miR-512-5p	CLIP-seq
MIRT1186603	hsa-miR-557	CLIP-seq
MIRT1186604	hsa-miR-620	CLIP-seq
MIRT1186605	hsa-miR-761	CLIP-seq
MIRT1186606	hsa-miR-922	CLIP-seq
MIRT1186607	hsa-miR-936	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186567	hsa-miR-15a	CLIP-seq
MIRT1186568	hsa-miR-15b	CLIP-seq
MIRT1186569	hsa-miR-16	CLIP-seq
MIRT1186571	hsa-miR-195	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT2054073	hsa-miR-3127-3p	CLIP-seq
MIRT2054074	hsa-miR-3183	CLIP-seq
MIRT2054075	hsa-miR-328	CLIP-seq
MIRT2054076	hsa-miR-3911	CLIP-seq
MIRT2054077	hsa-miR-3921	CLIP-seq
MIRT1186583	hsa-miR-424	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2054079	hsa-miR-4302	CLIP-seq
MIRT2054080	hsa-miR-4446-5p	CLIP-seq
MIRT2054081	hsa-miR-4519	CLIP-seq
MIRT2054082	hsa-miR-4653-5p	CLIP-seq
MIRT2054083	hsa-miR-4723-3p	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT2054084	hsa-miR-4755-5p	CLIP-seq
MIRT2054085	hsa-miR-4768-5p	CLIP-seq
MIRT1186599	hsa-miR-497	CLIP-seq
MIRT2054086	hsa-miR-511	CLIP-seq
MIRT2054087	hsa-miR-642a	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT2283223	hsa-miR-3920	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2283224	hsa-miR-4491	CLIP-seq
MIRT2283225	hsa-miR-4496	CLIP-seq
MIRT2283226	hsa-miR-4657	CLIP-seq
MIRT2283227	hsa-miR-4668-3p	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT2283228	hsa-miR-4762-3p	CLIP-seq
MIRT2283229	hsa-miR-4777-3p	CLIP-seq
MIRT2283230	hsa-miR-4789-5p	CLIP-seq
MIRT2283231	hsa-miR-508-5p	CLIP-seq
MIRT2054086	hsa-miR-511	CLIP-seq
MIRT2283232	hsa-miR-518a-5p	CLIP-seq
MIRT2283233	hsa-miR-527	CLIP-seq
MIRT2283234	hsa-miR-665	CLIP-seq
MIRT1186566	hsa-miR-1538	CLIP-seq
MIRT1186572	hsa-miR-1976	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT1186595	hsa-miR-4745-3p	CLIP-seq
MIRT2455237	hsa-miR-3613-3p	CLIP-seq
MIRT2455238	hsa-miR-376c	CLIP-seq
MIRT2455239	hsa-miR-4684-3p	CLIP-seq
MIRT2455240	hsa-miR-4781-3p	CLIP-seq
MIRT2455241	hsa-miR-4789-3p	CLIP-seq
MIRT2283232	hsa-miR-518a-5p	CLIP-seq
MIRT2283233	hsa-miR-527	CLIP-seq
MIRT2581486	hsa-miR-10a	CLIP-seq
MIRT2581487	hsa-miR-10b	CLIP-seq
MIRT2581488	hsa-miR-1229	CLIP-seq
MIRT2581489	hsa-miR-1276	CLIP-seq
MIRT2581490	hsa-miR-1278	CLIP-seq
MIRT2581491	hsa-miR-1291	CLIP-seq
MIRT2581492	hsa-miR-154	CLIP-seq
MIRT2581493	hsa-miR-191	CLIP-seq
MIRT2581494	hsa-miR-2110	CLIP-seq
MIRT2581495	hsa-miR-2113	CLIP-seq
MIRT2581496	hsa-miR-218	CLIP-seq
MIRT2581497	hsa-miR-2278	CLIP-seq
MIRT2581498	hsa-miR-3121-5p	CLIP-seq
MIRT2581499	hsa-miR-3144-5p	CLIP-seq
MIRT2581500	hsa-miR-3150a-3p	CLIP-seq
MIRT2581501	hsa-miR-3155	CLIP-seq
MIRT2581502	hsa-miR-3155b	CLIP-seq
MIRT2581503	hsa-miR-3191	CLIP-seq
MIRT2581504	hsa-miR-320e	CLIP-seq
MIRT2054075	hsa-miR-328	CLIP-seq
MIRT2581505	hsa-miR-3647-3p	CLIP-seq
MIRT2054077	hsa-miR-3921	CLIP-seq
MIRT2581506	hsa-miR-409-5p	CLIP-seq
MIRT2581507	hsa-miR-4260	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2581508	hsa-miR-4311	CLIP-seq
MIRT2581509	hsa-miR-4468	CLIP-seq
MIRT2581510	hsa-miR-4495	CLIP-seq
MIRT2581511	hsa-miR-4528	CLIP-seq
MIRT2581512	hsa-miR-4652-5p	CLIP-seq
MIRT2054082	hsa-miR-4653-5p	CLIP-seq
MIRT2581513	hsa-miR-4709-5p	CLIP-seq
MIRT2581514	hsa-miR-4715-3p	CLIP-seq
MIRT2581515	hsa-miR-4747-5p	CLIP-seq
MIRT2054085	hsa-miR-4768-5p	CLIP-seq
MIRT2581516	hsa-miR-4794	CLIP-seq
MIRT2581517	hsa-miR-484	CLIP-seq
MIRT2581518	hsa-miR-488	CLIP-seq
MIRT2581519	hsa-miR-553	CLIP-seq
MIRT2581520	hsa-miR-576-5p	CLIP-seq
MIRT2581521	hsa-miR-583	CLIP-seq
MIRT2581522	hsa-miR-660	CLIP-seq
MIRT2581523	hsa-miR-711	CLIP-seq
MIRT2581524	hsa-miR-767-3p	CLIP-seq
MIRT2581486	hsa-miR-10a	CLIP-seq
MIRT2581487	hsa-miR-10b	CLIP-seq
MIRT2581489	hsa-miR-1276	CLIP-seq
MIRT2581491	hsa-miR-1291	CLIP-seq
MIRT2581492	hsa-miR-154	CLIP-seq
MIRT2581495	hsa-miR-2113	CLIP-seq
MIRT2581497	hsa-miR-2278	CLIP-seq
MIRT2581498	hsa-miR-3121-5p	CLIP-seq
MIRT2581501	hsa-miR-3155	CLIP-seq
MIRT2581502	hsa-miR-3155b	CLIP-seq
MIRT2581504	hsa-miR-320e	CLIP-seq
MIRT2054075	hsa-miR-328	CLIP-seq
MIRT2054077	hsa-miR-3921	CLIP-seq
MIRT2581506	hsa-miR-409-5p	CLIP-seq
MIRT2581507	hsa-miR-4260	CLIP-seq
MIRT2054078	hsa-miR-4279	CLIP-seq
MIRT2581508	hsa-miR-4311	CLIP-seq
MIRT2581509	hsa-miR-4468	CLIP-seq
MIRT2581510	hsa-miR-4495	CLIP-seq
MIRT2054082	hsa-miR-4653-5p	CLIP-seq
MIRT2581513	hsa-miR-4709-5p	CLIP-seq
MIRT2581514	hsa-miR-4715-3p	CLIP-seq
MIRT2054085	hsa-miR-4768-5p	CLIP-seq
MIRT2686380	hsa-miR-4790-3p	CLIP-seq
MIRT2581517	hsa-miR-484	CLIP-seq
MIRT2581520	hsa-miR-576-5p	CLIP-seq
MIRT2581521	hsa-miR-583	CLIP-seq
MIRT2581522	hsa-miR-660	CLIP-seq
MIRT2581524	hsa-miR-767-3p	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
AR	Activation	16697957;17303007
AR	Unknown	11238180
ETS1	Activation	20842667
MSX2	Activation	22848398
PITX1	Repression	21425961
SOX4	Unknown	20019190
TP53	Repression	17202838

Show/Hide all (94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19597465
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19263243, 20855495
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18974119
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	18794125
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001655	Process	Urogenital system development	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	20855495
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11137288
GO:0004879	Function	Nuclear receptor activity	IDA	19886863
GO:0005515	Function	Protein binding	IPI	17234752, 18077445, 19797053, 27339988, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	20855495
GO:0005634	Component	Nucleus	IDA	18757402, 19263243
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	11137288
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	11137288
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IDA	20395202
GO:0007431	Process	Salivary gland development	IEA
GO:0007431	Process	Salivary gland development	ISS
GO:0007507	Process	Heart development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18360715
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	19266349
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	17486276, 20599703
GO:0010628	Process	Positive regulation of gene expression	IMP	20716579
GO:0010629	Process	Negative regulation of gene expression	IDA	17486276
GO:0030154	Process	Cell differentiation	IBA
GO:0030331	Function	Nuclear estrogen receptor binding	IDA	18794125
GO:0030521	Process	Androgen receptor signaling pathway	IDA	19886863
GO:0030850	Process	Prostate gland development	IEA
GO:0032880	Process	Regulation of protein localization	IMP	20395202
GO:0033574	Process	Response to testosterone	IEA
GO:0033574	Process	Response to testosterone	ISS
GO:0033993	Process	Response to lipid	IEA
GO:0035907	Process	Dorsal aorta development	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	18974119
GO:0043565	Function	Sequence-specific DNA binding	IDA	19780584
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043569	Process	Negative regulation of insulin-like growth factor receptor signaling pathway	IEA
GO:0043569	Process	Negative regulation of insulin-like growth factor receptor signaling pathway	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18794125
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18360715, 18974119
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	18360715
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	20855495
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19797053, 20855495
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	ISS
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051781	Process	Positive regulation of cell division	IMP	20855495
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	20395202
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060442	Process	Branching involved in prostate gland morphogenesis	IEA
GO:0060442	Process	Branching involved in prostate gland morphogenesis	ISS
GO:0060664	Process	Epithelial cell proliferation involved in salivary gland morphogenesis	IEA
GO:0060664	Process	Epithelial cell proliferation involved in salivary gland morphogenesis	ISS
GO:0060767	Process	Epithelial cell proliferation involved in prostate gland development	IEA
GO:0060770	Process	Negative regulation of epithelial cell proliferation involved in prostate gland development	IEA
GO:0060770	Process	Negative regulation of epithelial cell proliferation involved in prostate gland development	ISS
GO:0071347	Process	Cellular response to interleukin-1	IEP	18757402
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	18757402
GO:0071383	Process	Cellular response to steroid hormone stimulus	IDA	19886863
GO:0071456	Process	Cellular response to hypoxia	IDA	21056661
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEP	18757402
GO:0090734	Component	Site of DNA damage	IDA	20395202
GO:0097162	Function	MADS box domain binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	18296735, 20716579
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	18794125
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000836	Process	Positive regulation of androgen secretion	IDA	19886863
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IDA	17486276

MIM	HGNC	e!Ensembl
602041	7838	ENSG00000167034

Q99801

Protein name

Homeobox protein Nkx-3.1 (Homeobox protein NK-3 homolog A)

Protein function

Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and i

PDB

2L9R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	125 → 181	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the prostate and, at a lower level, in the testis. {ECO:0000269|PubMed:9226374, ECO:0000269|PubMed:9537602}.

Sequence

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP
EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP
KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK
RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW

Sequence length

234

Interactions

View interactions

	KEGG
	Pathways in cancer Prostate cancer

NKX3-1 (NK3 homeobox 1)