Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4808
Gene name Gene Name - the full gene name approved by the HGNC.	Nescient helix-loop-helix 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NHLH2
Synonyms (NCBI Gene) Gene synonyms aliases	HEN2, HH27, NSCL2, bHLHa34
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HH27
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.1

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450041	hsa-miR-4714-5p	PAR-CLIP	22100165
MIRT450040	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT450039	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT450038	hsa-miR-4635	PAR-CLIP	22100165
MIRT450037	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT450041	hsa-miR-4714-5p	PAR-CLIP	22100165
MIRT450040	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT450039	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT450038	hsa-miR-4635	PAR-CLIP	22100165
MIRT450037	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT1184301	hsa-miR-154	CLIP-seq
MIRT1184302	hsa-miR-3065-5p	CLIP-seq
MIRT1184303	hsa-miR-3133	CLIP-seq
MIRT1184304	hsa-miR-342-3p	CLIP-seq
MIRT1184305	hsa-miR-3613-3p	CLIP-seq
MIRT1184306	hsa-miR-4695-3p	CLIP-seq
MIRT1184307	hsa-miR-498	CLIP-seq
MIRT1184308	hsa-miR-548ac	CLIP-seq
MIRT1184309	hsa-miR-548b-3p	CLIP-seq
MIRT1184310	hsa-miR-548d-3p	CLIP-seq
MIRT1184311	hsa-miR-548z	CLIP-seq
MIRT1184301	hsa-miR-154	CLIP-seq
MIRT2686291	hsa-miR-27a	CLIP-seq
MIRT2686292	hsa-miR-27b	CLIP-seq
MIRT2686293	hsa-miR-3919	CLIP-seq
MIRT2686294	hsa-miR-3925-5p	CLIP-seq
MIRT2686295	hsa-miR-494	CLIP-seq
MIRT2686296	hsa-miR-513a-5p	CLIP-seq
MIRT2686297	hsa-miR-922	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	16314316
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0005515	Function	Protein binding	IPI	22169038, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	TAS	16314316
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006915	Process	Apoptotic process	IEA
GO:0007417	Process	Central nervous system development	TAS	1328219
GO:0008584	Process	Male gonad development	IEA
GO:0021535	Process	Cell migration in hindbrain	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0042698	Process	Ovulation cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	16314316
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	TAS	16314316
GO:0060179	Process	Male mating behavior	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
162361	7818	ENSG00000177551

Protein

UniProt ID

Q02577

Protein name

Helix-loop-helix protein 2 (HEN-2) (Class A basic helix-loop-helix protein 34) (bHLHa34) (Nescient helix loop helix 2) (NSCL-2)

Protein function

Transcription factor which binds the E box motif 5'-CA[TC][AG]TG-3'. Involved in regulating energy expenditure, body mass, voluntary physical activity, mating behavior and reproductive longevity, acting through the hypothalamic-pituitary-gonadal

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	78 → 130	Helix-loop-helix DNA-binding domain	Domain

Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHP
QQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILR
LAICYISYLNHVLDV

Sequence length

135

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	20808804

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Hypogonadotropic Hypogonadism	hypogonadotropic hypogonadism 27 without anosmia			GenCC

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Renal Cell	Associate	36232491
COVID 19	Associate	35866388
Genetic Diseases Inborn	Associate	36834605
Infertility	Associate	36834605
Neoplasm Metastasis	Associate	36232491
Neuroblastoma	Associate	21573214
Obesity	Associate	36834605
Periodontitis	Associate	27302879
Prader Willi Syndrome	Associate	36834605

NHLH2 (nescient helix-loop-helix 2)