Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	4804
Gene name	Nerve growth factor receptor
Gene symbol	NGFR
Synonyms (NCBI Gene)	CD271Gp80-LNGFRTNFRSF16p75(NTR)p75NTR
Chromosome	17
Chromosome location	17q21.33
Summary	Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic

104

Show/Hide all (104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016762	hsa-miR-335-5p	Microarray	18185580
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT1184143	hsa-miR-1827	CLIP-seq
MIRT1184144	hsa-miR-1909	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT1184147	hsa-miR-28-5p	CLIP-seq
MIRT1184148	hsa-miR-3139	CLIP-seq
MIRT1184149	hsa-miR-3150a-3p	CLIP-seq
MIRT1184150	hsa-miR-3175	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT1184153	hsa-miR-3670	CLIP-seq
MIRT1184154	hsa-miR-3936	CLIP-seq
MIRT1184155	hsa-miR-3943	CLIP-seq
MIRT1184156	hsa-miR-4277	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT1184159	hsa-miR-4688	CLIP-seq
MIRT1184160	hsa-miR-4722-3p	CLIP-seq
MIRT1184161	hsa-miR-4727-5p	CLIP-seq
MIRT1184162	hsa-miR-4768-5p	CLIP-seq
MIRT1184163	hsa-miR-498	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184166	hsa-miR-708	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT1184168	hsa-miR-939	CLIP-seq
MIRT1184169	hsa-miR-942	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT2053383	hsa-miR-2467-3p	CLIP-seq
MIRT2053384	hsa-miR-3126-5p	CLIP-seq
MIRT2053385	hsa-miR-3173-3p	CLIP-seq
MIRT2053386	hsa-miR-3184	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT2053387	hsa-miR-377	CLIP-seq
MIRT2053388	hsa-miR-3941	CLIP-seq
MIRT2053389	hsa-miR-423-5p	CLIP-seq
MIRT2053390	hsa-miR-4324	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053392	hsa-miR-466	CLIP-seq
MIRT2053393	hsa-miR-4672	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2053395	hsa-miR-4695-5p	CLIP-seq
MIRT2053396	hsa-miR-4779	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT2282604	hsa-miR-186	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT2282605	hsa-miR-2964a-3p	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT2282606	hsa-miR-4505	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2282607	hsa-miR-513a-5p	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT2391537	hsa-miR-2681	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYCN	Repression	21123453

Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0001678	Process	Intracellular glucose homeostasis	ISS
GO:0001942	Process	Hair follicle development	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	1846035
GO:0005035	Function	Death receptor activity	IBA
GO:0005035	Function	Death receptor activity	IEA
GO:0005035	Function	Death receptor activity	IGI	11927634
GO:0005515	Function	Protein binding	IPI	11756426, 14593116, 14966521, 14985763, 19131967, 20659559, 21982860, 23559013, 32814053
GO:0005516	Function	Calmodulin binding	IDA	24914971
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16712417
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3022937
GO:0005911	Component	Cell-cell junction	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	16712417
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015026	Function	Coreceptor activity	IBA
GO:0015026	Function	Coreceptor activity	IDA	16712417
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11927634
GO:0016048	Process	Detection of temperature stimulus	IEA
GO:0021675	Process	Nerve development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	27927008
GO:0030426	Component	Growth cone	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031267	Function	Small GTPase binding	ISS
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0035907	Process	Dorsal aorta development	IEA
GO:0038023	Function	Signaling receptor activity	TAS	3022937
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042488	Process	Positive regulation of odontogenesis of dentin-containing tooth	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043121	Function	Neurotrophin binding	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043226	Component	Organelle	IEA
GO:0043588	Process	Skin development	IEA
GO:0045202	Component	Synapse	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048406	Function	Nerve growth factor binding	IBA
GO:0048406	Function	Nerve growth factor binding	IEA
GO:0048406	Function	Nerve growth factor binding	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051402	Process	Neuron apoptotic process	IGI	11927634
GO:0051799	Process	Negative regulation of hair follicle development	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	26268439
GO:0098793	Component	Presynapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26268439
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	26268439
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	26268439
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11927634
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	26268439
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
162010	7809	ENSG00000064300

P08138

Protein name

Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (Low-affinity nerve growth factor receptor p75NGFR) (Low-affinity nerve growth factor

Protein function

Low affinity receptor which can bind to NGF, BDNF, NTF3, and NTF4. Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF, BDNF and NTF3 with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:24

PDB

2N80 , 2N83 , 2N97 , 3EWV , 5ZGG , 7CSQ , 8X8T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	109 → 146	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	149 → 188	TNFR/NGFR cysteine-rich region	Domain
PF18422	TNFR_16_TM	246 → 283	Tumor necrosis factor receptor member 16 trans-membrane domain	Domain
PF00531	Death	344 → 421	Death domain	Domain

Sequence

MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV

Sequence length

427

Interactions

View interactions

	KEGG		Reactome
	Virion - Ebolavirus, Lyssavirus and Morbillivirus MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway Apoptosis - multiple species Neurotrophin signaling pathway Transcriptional misregulation in cancer		Axonal growth inhibition (RHOA activation) Regulated proteolysis of p75NTR NFG and proNGF binds to p75NTR NADE modulates death signalling NRIF signals cell death from the nucleus p75NTR recruits signalling complexes NF-kB is activated and signals survival Axonal growth stimulation

NGFR (nerve growth factor receptor)