Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4804
Gene name Gene Name - the full gene name approved by the HGNC.	Nerve growth factor receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NGFR
Synonyms (NCBI Gene) Gene synonyms aliases	CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.33
Summary Summary of gene provided in NCBI Entrez Gene.	Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic

Show/Hide all(104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016762	hsa-miR-335-5p	Microarray	18185580
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT1184143	hsa-miR-1827	CLIP-seq
MIRT1184144	hsa-miR-1909	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT1184147	hsa-miR-28-5p	CLIP-seq
MIRT1184148	hsa-miR-3139	CLIP-seq
MIRT1184149	hsa-miR-3150a-3p	CLIP-seq
MIRT1184150	hsa-miR-3175	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT1184153	hsa-miR-3670	CLIP-seq
MIRT1184154	hsa-miR-3936	CLIP-seq
MIRT1184155	hsa-miR-3943	CLIP-seq
MIRT1184156	hsa-miR-4277	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT1184159	hsa-miR-4688	CLIP-seq
MIRT1184160	hsa-miR-4722-3p	CLIP-seq
MIRT1184161	hsa-miR-4727-5p	CLIP-seq
MIRT1184162	hsa-miR-4768-5p	CLIP-seq
MIRT1184163	hsa-miR-498	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184166	hsa-miR-708	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT1184168	hsa-miR-939	CLIP-seq
MIRT1184169	hsa-miR-942	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT2053383	hsa-miR-2467-3p	CLIP-seq
MIRT2053384	hsa-miR-3126-5p	CLIP-seq
MIRT2053385	hsa-miR-3173-3p	CLIP-seq
MIRT2053386	hsa-miR-3184	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT2053387	hsa-miR-377	CLIP-seq
MIRT2053388	hsa-miR-3941	CLIP-seq
MIRT2053389	hsa-miR-423-5p	CLIP-seq
MIRT2053390	hsa-miR-4324	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053392	hsa-miR-466	CLIP-seq
MIRT2053393	hsa-miR-4672	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2053395	hsa-miR-4695-5p	CLIP-seq
MIRT2053396	hsa-miR-4779	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT2282604	hsa-miR-186	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT2282605	hsa-miR-2964a-3p	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT2282606	hsa-miR-4505	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2282607	hsa-miR-513a-5p	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT2391537	hsa-miR-2681	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MYCN	Repression	21123453

Show/Hide all(63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0001678	Process	Cellular glucose homeostasis	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	1846035
GO:0005035	Function	Death receptor activity	IBA	21873635
GO:0005035	Function	Death receptor activity	IGI	11927634
GO:0005515	Function	Protein binding	IPI	11756426, 14593116, 14966521, 14985763, 19131967, 19225519, 20659559, 21982860, 23559013, 32814053
GO:0005516	Function	Calmodulin binding	IDA	24914971
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005768	Component	Endosome	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	16712417
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	3022937
GO:0005911	Component	Cell-cell junction	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	26268439
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0007266	Process	Rho protein signal transduction	IBA	21873635
GO:0007266	Process	Rho protein signal transduction	IDA	16712417
GO:0007411	Process	Axon guidance	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0015026	Function	Coreceptor activity	IBA	21873635
GO:0015026	Function	Coreceptor activity	IDA	16712417
GO:0016021	Component	Integral component of membrane	NAS	11927634
GO:0016048	Process	Detection of temperature stimulus	IEA
GO:0021675	Process	Nerve development	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031267	Function	Small GTPase binding	ISS
GO:0031293	Process	Membrane protein intracellular domain proteolysis	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0035907	Process	Dorsal aorta development	IEA
GO:0038023	Function	Signaling receptor activity	TAS	3022937
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042488	Process	Positive regulation of odontogenesis of dentin-containing tooth	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043121	Function	Neurotrophin binding	ISS
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043281	Process	Regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	TAS
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048406	Function	Nerve growth factor binding	IBA	21873635
GO:0048406	Function	Nerve growth factor binding	ISS
GO:0050771	Process	Negative regulation of axonogenesis	TAS
GO:0050772	Process	Positive regulation of axonogenesis	TAS
GO:0051402	Process	Neuron apoptotic process	IGI	11927634
GO:0051799	Process	Negative regulation of hair follicle development	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26268439
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	26268439
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	26268439
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11927634
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
162010	7809	ENSG00000064300

Protein

UniProt ID

P08138

Protein name

Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (Low-affinity nerve growth factor receptor p75NGFR) (Low-affinity nerve growth factor

Protein function

Low affinity receptor which can bind to NGF, BDNF, NTF3, and NTF4. Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF, BDNF and NTF3 with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:24

PDB

2N80 , 2N83 , 2N97 , 3EWV , 5ZGG , 7CSQ , 8X8T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	109 → 146	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	149 → 188	TNFR/NGFR cysteine-rich region	Domain
PF18422	TNFR_16_TM	246 → 283	Tumor necrosis factor receptor member 16 trans-membrane domain	Domain
PF00531	Death	344 → 421	Death domain	Domain

Sequence

MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV

Sequence length

427

Interactions

View interactions

	KEGG		Reactome
	Virion - Ebolavirus, Lyssavirus and Morbillivirus MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway Apoptosis - multiple species Neurotrophin signaling pathway Transcriptional misregulation in cancer		Axonal growth inhibition (RHOA activation) Regulated proteolysis of p75NTR NFG and proNGF binds to p75NTR NADE modulates death signalling NRIF signals cell death from the nucleus p75NTR recruits signalling complexes NF-kB is activated and signals survival Axonal growth stimulation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	18056468, 17409433
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	18470533
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061 View all (179 more)	10436046

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder	15883381, 15274039	ClinVar
Bipolar Disorder	Bipolar Disorder		GWAS

Show/Hide Text Mining Associations (146)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	36074475
Abortion Spontaneous	Associate	33565696
Acne Vulgaris	Inhibit	8396608
Acquired Immunodeficiency Syndrome	Associate	16119986
Airway Obstruction	Associate	34915763
Alzheimer Disease	Associate	16539663, 22236693, 26738357, 28558704, 31745181, 36074475, 36189598
Ameloblastoma	Associate	27737362
Arthritis	Associate	35309353
Arthritis Psoriatic	Associate	25330297
Arthritis Rheumatoid	Inhibit	26355501
Arthritis Rheumatoid	Associate	33673283, 35309353
Astrocytoma	Associate	1649553
Attention Deficit Disorder with Hyperactivity	Associate	28630479
Bone Cysts	Associate	32636407
Brain Injuries	Associate	32917932
Brain Neoplasms	Associate	1649553, 24519935, 36435874
Brain Neoplasms	Stimulate	28852061
Breast Carcinoma In Situ	Associate	16424897
Breast Neoplasms	Associate	10606728, 17617666, 18716795, 22161836, 23677713, 23831066, 26673618, 40629424
Breast Neoplasms	Stimulate	16424897
Burning Mouth Syndrome	Associate	30886243
Bursitis	Stimulate	36008780
Calcinosis Cutis	Associate	25674270
Carcinogenesis	Associate	22558167
Carcinoma Hepatocellular	Associate	33378013, 36785674
Carcinoma Intraductal Noninfiltrating	Associate	16424897
Carcinoma Renal Cell	Associate	27120782
Cardiomyopathy Hypertrophic	Associate	7828981
Cell Transformation Neoplastic	Associate	25105565, 28447720, 38016691
Cerebral Infarction	Associate	29499660
Chronobiology Disorders	Associate	26278479
Colonic Neoplasms	Associate	33140821
Colorectal Neoplasms	Associate	25244921, 26494939, 29945573, 32235004, 33820868, 34541005, 36890467
Cystitis	Associate	24252413
Deltaretrovirus Infections	Associate	35746645
Dementia	Associate	26738357
Depressive Disorder Major	Associate	26278479
Diabetes Mellitus Type 2	Associate	22236693
Disease	Associate	7828981
Drug Related Side Effects and Adverse Reactions	Associate	23314735
Drug Resistant Epilepsy	Associate	29224250
Edema	Stimulate	12821676
Endometriosis	Inhibit	18061173
Endometriosis	Associate	18976764
Ependymoma	Associate	1649553
Esophageal Squamous Cell Carcinoma	Associate	16832412, 25351876, 26897248, 31698654
Fatty Liver	Associate	31132579
Ganglioneuroblastoma	Associate	1649553
Giant Cell Arteritis	Associate	25418464
Glioblastoma	Associate	19288188, 24519935, 27927008, 33351787, 34899682, 35393432
Glioma	Associate	1649553, 22558167, 24519935
Glioma	Stimulate	23576602
Glomus vagale tumors	Associate	26278479
Hemangiopericytoma	Associate	2456020
Hepatitis Viral Human	Associate	31996124
Hereditary Sensory and Autonomic Neuropathies	Associate	23799134, 33229797, 8696348
Hirschsprung Disease	Associate	11854929, 7828981
Hyperalgesia	Stimulate	35925599
Hyperplasia	Associate	16424897
Hypesthesia	Associate	16906282
Hypopharyngeal Neoplasms	Associate	27469492, 36273237
Hypothyroidism	Associate	33600668
Hypoxia	Associate	35163127
Infections	Associate	35746645
Inflammation	Associate	11028855, 25816145, 35009001
Inflammation	Stimulate	35309353
Keratoconus	Associate	16275928
Kidney Neoplasms	Associate	27120782
Lead Poisoning Nervous System	Associate	29749806
Leprosy	Associate	16906282
Leukemia Myeloid	Associate	18403643
Leukemia Myeloid Acute	Associate	3006050
Leukemia Promyelocytic Acute	Associate	3006050
Liver Cirrhosis	Associate	21212030, 25816145
Liver Diseases	Associate	25816145
Lung Neoplasms	Stimulate	29802376
Lymphatic Metastasis	Associate	31698654
Macular Degeneration	Associate	34569899
Mastocytoma	Associate	21501463
Medulloblastoma	Associate	26497209, 7526237, 9420431
Melanoma	Associate	18305571, 1850772, 21418516, 22157936, 24390218, 25105565, 25223735, 25351876, 25830652, 26494317, 27477289, 28852061, 31118427, 35163127, 35457078 View all (5 more)
Melanoma	Inhibit	24226422
Melanoma	Stimulate	25674270
Memory Disorders	Associate	26738357
Mouth Diseases	Associate	18976764
Mouth Neoplasms	Associate	35925599
Multicystic Dysplastic Kidney	Stimulate	27737362
Multiple Myeloma	Associate	17626627
Myelodysplastic Syndromes	Associate	22710983
Myeloproliferative Disorders	Stimulate	18403643
Myotonic Dystrophy	Associate	26806620
N syndrome	Associate	29945573
Neoplasm Invasiveness	Associate	26897248
Neoplasm Metastasis	Associate	26897248, 31569361, 35925599, 40629424
Neoplasm Metastasis	Inhibit	27477289
Neoplasm Metastasis	Stimulate	28852061
Neoplasms	Inhibit	16424897, 27469492, 35758042
Neoplasms	Associate	17626627, 19288188, 23314735, 23472067, 23576602, 24226422, 24519935, 2456020, 2475341, 25351876, 25561796, 25674270, 25830652, 26311223, 26494317 View all (21 more)
Neoplasms	Stimulate	19396155
Neoplasms Squamous Cell	Associate	31331058
Neural crest tumor	Associate	29434243
Neurilemmoma	Associate	25189642
Neuroblastoma	Associate	1314950, 21419569, 22253825, 23314735, 24253178, 24736663, 26843908, 7526237, 8441429
Neuroblastoma	Stimulate	1649553
Neurodegenerative Diseases	Associate	32917932, 33253821
Neuroectodermal Tumors	Associate	7526237
Neuroectodermal Tumors Primitive	Associate	1649553, 7526237
Neuroendocrine Tumors	Associate	35048633
Neurofibrosarcoma	Associate	25189642
Neurologic Manifestations	Associate	33643311
Nevus	Associate	1850772
Osteoarthritis	Associate	31132579, 32636407
Osteoarthritis Hip	Associate	32636407
Pain	Associate	29562624, 35925599
Pancreatic Neoplasms	Associate	27792755, 33820868
Paraparesis Tropical Spastic	Associate	35746645
Parkinson Disease	Associate	31159890, 33253821
Parkinson Disease 10	Associate	26738357
Pemphigoid Benign Mucous Membrane	Associate	26569118
Pheochromocytoma	Associate	28162975
Polycystic Ovary Syndrome	Associate	33622336
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16173964, 17910636
Premature Birth	Associate	33565696
Primary Myelofibrosis	Stimulate	19396155
Prostatic Neoplasms	Associate	11442674
Sarcoma	Associate	23283492
Sarcoma Ewing	Associate	18212050
Schwannomatosis	Associate	26657314
Sclerosis	Associate	16258511
Soft Tissue Neoplasms	Associate	2456020
Squamous Cell Carcinoma of Head and Neck	Associate	28447720, 29904026, 31569361, 35925599
Stillbirth	Associate	33565696
Stomach Neoplasms	Associate	35758042
Stroke	Associate	29499660
Tarlov Cysts	Associate	35925599
Thyroid cancer medullary	Associate	1362425
Thyroid Carcinoma Anaplastic	Stimulate	29037860
Thyroid Neoplasms	Associate	29037860
Thyroiditis Autoimmune	Inhibit	33600668
Tinnitus	Associate	37736859
Urethral Diseases	Stimulate	24252413
Urinary Bladder Neoplasms	Associate	38016691
Uveal melanoma	Associate	27565163
Vitamin B 12 Deficiency	Stimulate	19959661
Wilms Tumor	Associate	30664180
Wounds and Injuries	Associate	30046375

NGFR (nerve growth factor receptor)