Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4804
Gene name Gene Name - the full gene name approved by the HGNC.
Nerve growth factor receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NGFR
Synonyms (NCBI Gene) Gene synonyms aliases
CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016762 hsa-miR-335-5p Microarray 18185580
MIRT472231 hsa-miR-6507-3p PAR-CLIP 23592263
MIRT472230 hsa-miR-1321 PAR-CLIP 23592263
MIRT472229 hsa-miR-4739 PAR-CLIP 23592263
MIRT472228 hsa-miR-4756-5p PAR-CLIP 23592263
Transcription factors
Transcription factor Regulation Reference
MYCN Repression 21123453
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding TAS 26871627
GO:0001678 Process Intracellular glucose homeostasis IEA
GO:0001678 Process Intracellular glucose homeostasis ISS
GO:0001942 Process Hair follicle development IEA
GO:0004888 Function Transmembrane signaling receptor activity TAS 1846035
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
162010 7809 ENSG00000064300
Protein
UniProt ID P08138
Protein name Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (Low-affinity nerve growth factor receptor p75NGFR) (Low-affinity nerve growth factor
Protein function Low affinity receptor which can bind to NGF, BDNF, NTF3, and NTF4. Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF, BDNF and NTF3 with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:24
PDB 2N80 , 2N83 , 2N97 , 3EWV , 5ZGG , 7CSQ , 8X8T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 109 146 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 149 188 TNFR/NGFR cysteine-rich region Domain
PF18422 TNFR_16_TM 246 283 Tumor necrosis factor receptor member 16 trans-membrane domain Domain
PF00531 Death 344 421 Death domain Domain
Sequence
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVC
EECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAEC
EEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
S
TATSPV
Sequence length 427
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Virion - Ebolavirus, Lyssavirus and Morbillivirus
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis - multiple species
Neurotrophin signaling pathway
Transcriptional misregulation in cancer
  Axonal growth inhibition (RHOA activation)
Regulated proteolysis of p75NTR
NFG and proNGF binds to p75NTR
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 36074475
Abortion Spontaneous Associate 33565696
Acne Vulgaris Inhibit 8396608
Acquired Immunodeficiency Syndrome Associate 16119986
Airway Obstruction Associate 34915763
Alzheimer Disease Associate 16539663, 22236693, 26738357, 28558704, 31745181, 36074475, 36189598
Ameloblastoma Associate 27737362
Arthritis Associate 35309353
Arthritis Psoriatic Associate 25330297
Arthritis Rheumatoid Inhibit 26355501