NGF (nerve growth factor)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 4803
Gene name Nerve growth factor
Gene symbol NGF
Synonyms (NCBI Gene)
Beta-NGFHSAN5NGFB
Chromosome 1
Chromosome location 1p13.2
Summary This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the d
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT733688 hsa-let-7a-5p ELISALuciferase reporter assayqRT-PCRWestern blotting 31925656
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
Transcription factor Regulation Reference
FOS Unknown 2111020
ING4 Repression 22078444
JUN Unknown 2111020
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
60
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (60)
GO ID Ontology Definition Evidence Reference
GO:0004857 Function Enzyme inhibitor activity IEA
GO:0005102 Function Signaling receptor binding IEA
GO:0005163 Function Nerve growth factor receptor binding IBA
GO:0005163 Function Nerve growth factor receptor binding IPI 14985763
GO:0005515 Function Protein binding IPI 10490030, 14985763, 15131306, 15710408, 18596692, 19122660, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
162030 7808 ENSG00000134259
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01138
Protein name Beta-nerve growth factor (Beta-NGF)
Protein function Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems (PubMed:14976160, PubMed:20978020). Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades
PDB 1SG1 , 1WWW , 2IFG , 4EDW , 4EDX , 4ZBN , 5JZ7 , 6YW8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00243 NGF 128 → 238 Nerve growth factor family Domain
Sequence 
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
A
Sequence length 241
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels 		  NGF processing
Frs2-mediated activation
ARMS-mediated activation
Retrograde neurotrophin signalling
TRKA activation by NGF
PI3K/AKT activation
NFG and proNGF binds to p75NTR
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
164
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital sensory neuropathy with selective loss of small myelinated fibers Pathogenic; Likely pathogenic rs753382007, rs11466112, rs2101018240 RCV002606031
RCV000015089
RCV000022672
Peripheral neuropathy Pathogenic rs2101018240 RCV004798744
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Charcot-Marie-Tooth disease Uncertain significance rs1571069258, rs1326012011, rs1571069395 RCV000789668
RCV000789667
RCV000789501
NGF-related disorder Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance rs780383333, rs6325, rs11466111, rs565497625, rs150188752, rs201861727, rs11466110, rs147326889, rs781072056 RCV004738557
RCV004549635
RCV004549634
RCV004550991
RCV004551457
RCV004553172
RCV004737608
RCV004547776
RCV001824886
Show/Hide Text Mining Associations (247)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidemia isovaleric Associate 20690185
Adenocarcinoma Stimulate 29802376
Adenomyosis Associate 33305666
Alzheimer Disease Associate 21397006, 22330829, 23095849, 26302439, 27389402, 28498887, 28888073, 29582053, 32126838
Alzheimer Disease Stimulate 9453564
Alzheimer disease familial type 3 Associate 22330829
Amyotrophic Lateral Sclerosis Associate 29702606, 32174778
Aneuploidy Associate 28574013
Angiofibroma Associate 14567719
Anxiety Associate 22832952, 28413930