Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4802
Gene name Gene Name - the full gene name approved by the HGNC.	Nuclear transcription factor Y subunit gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NFYC
Synonyms (NCBI Gene) Gene synonyms aliases	CBF-C, CBFC, H1TF2A, HAP5, HSM, NF-YC
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B sub

Show/Hide all(92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007356	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT007356	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT020636	hsa-miR-155-5p	Proteomics	18668040
MIRT046926	hsa-miR-221-3p	CLASH	23622248
MIRT1184005	hsa-miR-1205	CLIP-seq
MIRT1184006	hsa-miR-1254	CLIP-seq
MIRT1184007	hsa-miR-1286	CLIP-seq
MIRT1184008	hsa-miR-1307	CLIP-seq
MIRT1184009	hsa-miR-130a	CLIP-seq
MIRT1184010	hsa-miR-130b	CLIP-seq
MIRT1184011	hsa-miR-142-3p	CLIP-seq
MIRT1184012	hsa-miR-199a-5p	CLIP-seq
MIRT1184013	hsa-miR-199b-5p	CLIP-seq
MIRT1184014	hsa-miR-301a	CLIP-seq
MIRT1184015	hsa-miR-301b	CLIP-seq
MIRT1184016	hsa-miR-3116	CLIP-seq
MIRT1184017	hsa-miR-3135b	CLIP-seq
MIRT1184018	hsa-miR-3150a-3p	CLIP-seq
MIRT1184019	hsa-miR-3175	CLIP-seq
MIRT1184020	hsa-miR-3197	CLIP-seq
MIRT1184021	hsa-miR-326	CLIP-seq
MIRT1184022	hsa-miR-330-5p	CLIP-seq
MIRT1184023	hsa-miR-342-5p	CLIP-seq
MIRT1184024	hsa-miR-361-3p	CLIP-seq
MIRT1184025	hsa-miR-3616-5p	CLIP-seq
MIRT1184026	hsa-miR-3622b-5p	CLIP-seq
MIRT1184027	hsa-miR-3647-5p	CLIP-seq
MIRT1184028	hsa-miR-3666	CLIP-seq
MIRT1184029	hsa-miR-3909	CLIP-seq
MIRT1184030	hsa-miR-4295	CLIP-seq
MIRT1184031	hsa-miR-4317	CLIP-seq
MIRT1184032	hsa-miR-4428	CLIP-seq
MIRT1184033	hsa-miR-4434	CLIP-seq
MIRT1184034	hsa-miR-4459	CLIP-seq
MIRT1184035	hsa-miR-4476	CLIP-seq
MIRT1184036	hsa-miR-4516	CLIP-seq
MIRT1184037	hsa-miR-4531	CLIP-seq
MIRT1184038	hsa-miR-454	CLIP-seq
MIRT1184039	hsa-miR-4635	CLIP-seq
MIRT1184040	hsa-miR-4638-5p	CLIP-seq
MIRT1184041	hsa-miR-4641	CLIP-seq
MIRT1184042	hsa-miR-4645-5p	CLIP-seq
MIRT1184043	hsa-miR-4651	CLIP-seq
MIRT1184044	hsa-miR-4664-5p	CLIP-seq
MIRT1184045	hsa-miR-4665-3p	CLIP-seq
MIRT1184046	hsa-miR-4667-5p	CLIP-seq
MIRT1184047	hsa-miR-4671-3p	CLIP-seq
MIRT1184048	hsa-miR-4673	CLIP-seq
MIRT1184049	hsa-miR-4695-5p	CLIP-seq
MIRT1184050	hsa-miR-4700-5p	CLIP-seq
MIRT1184051	hsa-miR-4722-5p	CLIP-seq
MIRT1184052	hsa-miR-518a-5p	CLIP-seq
MIRT1184053	hsa-miR-527	CLIP-seq
MIRT1184054	hsa-miR-573	CLIP-seq
MIRT1184055	hsa-miR-608	CLIP-seq
MIRT1184056	hsa-miR-637	CLIP-seq
MIRT1184057	hsa-miR-661	CLIP-seq
MIRT1184058	hsa-miR-676	CLIP-seq
MIRT1184059	hsa-miR-767-5p	CLIP-seq
MIRT1184060	hsa-miR-939	CLIP-seq
MIRT1184046	hsa-miR-4667-5p	CLIP-seq
MIRT1184050	hsa-miR-4700-5p	CLIP-seq
MIRT1184046	hsa-miR-4667-5p	CLIP-seq
MIRT1184050	hsa-miR-4700-5p	CLIP-seq
MIRT2580592	hsa-miR-1321	CLIP-seq
MIRT2580593	hsa-miR-1343	CLIP-seq
MIRT2580594	hsa-miR-155	CLIP-seq
MIRT2580595	hsa-miR-3074-5p	CLIP-seq
MIRT2580596	hsa-miR-3689d	CLIP-seq
MIRT2580597	hsa-miR-4328	CLIP-seq
MIRT2580598	hsa-miR-4739	CLIP-seq
MIRT2580599	hsa-miR-4756-5p	CLIP-seq
MIRT2580600	hsa-miR-541	CLIP-seq
MIRT2580601	hsa-miR-545	CLIP-seq
MIRT2580602	hsa-miR-586	CLIP-seq
MIRT2580603	hsa-miR-654-5p	CLIP-seq
MIRT2580592	hsa-miR-1321	CLIP-seq
MIRT2580593	hsa-miR-1343	CLIP-seq
MIRT2580594	hsa-miR-155	CLIP-seq
MIRT2580595	hsa-miR-3074-5p	CLIP-seq
MIRT2686272	hsa-miR-3192	CLIP-seq
MIRT2580596	hsa-miR-3689d	CLIP-seq
MIRT2686273	hsa-miR-4292	CLIP-seq
MIRT2686274	hsa-miR-4308	CLIP-seq
MIRT2580597	hsa-miR-4328	CLIP-seq
MIRT2580598	hsa-miR-4739	CLIP-seq
MIRT2580599	hsa-miR-4756-5p	CLIP-seq
MIRT2580600	hsa-miR-541	CLIP-seq
MIRT2580601	hsa-miR-545	CLIP-seq
MIRT2686275	hsa-miR-574-5p	CLIP-seq
MIRT2580602	hsa-miR-586	CLIP-seq
MIRT2580603	hsa-miR-654-5p	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	11256944
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11256944
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	21873635
GO:0003677	Function	DNA binding	IDA	15243141
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9332362, 10446203
GO:0005515	Function	Protein binding	IPI	12401788, 15243141, 20936779, 21988832, 23332751, 26496610
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	15243141, 15964792
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	15243141
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	10446203
GO:0006457	Process	Protein folding	TAS	10446203
GO:0008134	Function	Transcription factor binding	IEA
GO:0016602	Component	CCAAT-binding factor complex	IBA	21873635
GO:0016602	Component	CCAAT-binding factor complex	IDA	15243141
GO:0032993	Component	Protein-DNA complex	IDA	11256944
GO:0045540	Process	Regulation of cholesterol biosynthetic process	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	11256944

MIM	HGNC	e!Ensembl
605344	7806	ENSG00000066136

Protein

UniProt ID

Q13952

Protein name

Nuclear transcription factor Y subunit gamma (CAAT box DNA-binding protein subunit C) (Nuclear transcription factor Y subunit C) (NF-YC) (Transactivator HSM-1/2)

Protein function

Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on

PDB

1N1J , 4AWL , 4CSR , 6QMP , 6QMQ , 6QMS , 7AH8 , 8QU2 , 8QU3 , 8QU4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	9 → 107	Core histone H2A/H2B/H3/H4	Domain

Sequence

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTE
VQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAG
ASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD

Sequence length

458

Interactions

View interactions

	KEGG		Reactome
	Antigen processing and presentation Tuberculosis		PPARA activates gene expression Activation of gene expression by SREBF (SREBP) ATF6 (ATF6-alpha) activates chaperone genes

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Atrial Fibrillation	Inhibit	31888494
Diabetes Mellitus Type 2	Associate	31205951
Glioblastoma	Associate	37821547
Hearing Loss Noise Induced	Stimulate	17009596
Lumbar Stenosis Familial	Stimulate	23807322
Neoplasms	Associate	29505822, 37821547
Pulmonary Disease Chronic Obstructive	Associate	30845926
Stomach Neoplasms	Associate	24338397

NFYC (nuclear transcription factor Y subunit gamma)