Gene Gene information from NCBI Gene database.
Entrez ID 4802
Gene name Nuclear transcription factor Y subunit gamma
Gene symbol NFYC
Synonyms (NCBI Gene)
CBF-CCBFCH1TF2AHAP5HSMNF-YC
Chromosome 1
Chromosome location 1p34.2
Summary This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B sub
miRNA miRNA information provided by mirtarbase database.
92
miRTarBase ID miRNA Experiments Reference
MIRT007356 hsa-miR-33a-5p ImmunofluorescenceLuciferase reporter assayWestern blot 23547260
MIRT007356 hsa-miR-33a-5p ImmunofluorescenceLuciferase reporter assayWestern blot 23547260
MIRT020636 hsa-miR-155-5p Proteomics 18668040
MIRT046926 hsa-miR-221-3p CLASH 23622248
MIRT1184005 hsa-miR-1205 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 11256944
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11256944
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605344 7806 ENSG00000066136
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13952
Protein name Nuclear transcription factor Y subunit gamma (CAAT box DNA-binding protein subunit C) (Nuclear transcription factor Y subunit C) (NF-YC) (Transactivator HSM-1/2)
Protein function Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on
PDB 1N1J , 4AWL , 4CSR , 6QMP , 6QMQ , 6QMS , 7AH8 , 8QU2 , 8QU3 , 8QU4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00125 Histone 9 107 Core histone H2A/H2B/H3/H4 Domain
Sequence
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITK
FDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTE
VQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAG
ASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
Sequence length 458
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Antigen processing and presentation
Tuberculosis
  PPARA activates gene expression
Activation of gene expression by SREBF (SREBP)
ATF6 (ATF6-alpha) activates chaperone genes