Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4802
Gene name Gene Name - the full gene name approved by the HGNC.	Nuclear transcription factor Y subunit gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NFYC
Synonyms (NCBI Gene) Gene synonyms aliases	CBF-C, CBFC, H1TF2A, HAP5, HSM, NF-YC
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B sub

Show/Hide all(92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007356	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT007356	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT020636	hsa-miR-155-5p	Proteomics	18668040
MIRT046926	hsa-miR-221-3p	CLASH	23622248
MIRT1184005	hsa-miR-1205	CLIP-seq
MIRT1184006	hsa-miR-1254	CLIP-seq
MIRT1184007	hsa-miR-1286	CLIP-seq
MIRT1184008	hsa-miR-1307	CLIP-seq
MIRT1184009	hsa-miR-130a	CLIP-seq
MIRT1184010	hsa-miR-130b	CLIP-seq
MIRT1184011	hsa-miR-142-3p	CLIP-seq
MIRT1184012	hsa-miR-199a-5p	CLIP-seq
MIRT1184013	hsa-miR-199b-5p	CLIP-seq
MIRT1184014	hsa-miR-301a	CLIP-seq
MIRT1184015	hsa-miR-301b	CLIP-seq
MIRT1184016	hsa-miR-3116	CLIP-seq
MIRT1184017	hsa-miR-3135b	CLIP-seq
MIRT1184018	hsa-miR-3150a-3p	CLIP-seq
MIRT1184019	hsa-miR-3175	CLIP-seq
MIRT1184020	hsa-miR-3197	CLIP-seq
MIRT1184021	hsa-miR-326	CLIP-seq
MIRT1184022	hsa-miR-330-5p	CLIP-seq
MIRT1184023	hsa-miR-342-5p	CLIP-seq
MIRT1184024	hsa-miR-361-3p	CLIP-seq
MIRT1184025	hsa-miR-3616-5p	CLIP-seq
MIRT1184026	hsa-miR-3622b-5p	CLIP-seq
MIRT1184027	hsa-miR-3647-5p	CLIP-seq
MIRT1184028	hsa-miR-3666	CLIP-seq
MIRT1184029	hsa-miR-3909	CLIP-seq
MIRT1184030	hsa-miR-4295	CLIP-seq
MIRT1184031	hsa-miR-4317	CLIP-seq
MIRT1184032	hsa-miR-4428	CLIP-seq
MIRT1184033	hsa-miR-4434	CLIP-seq
MIRT1184034	hsa-miR-4459	CLIP-seq
MIRT1184035	hsa-miR-4476	CLIP-seq
MIRT1184036	hsa-miR-4516	CLIP-seq
MIRT1184037	hsa-miR-4531	CLIP-seq
MIRT1184038	hsa-miR-454	CLIP-seq
MIRT1184039	hsa-miR-4635	CLIP-seq
MIRT1184040	hsa-miR-4638-5p	CLIP-seq
MIRT1184041	hsa-miR-4641	CLIP-seq
MIRT1184042	hsa-miR-4645-5p	CLIP-seq
MIRT1184043	hsa-miR-4651	CLIP-seq
MIRT1184044	hsa-miR-4664-5p	CLIP-seq
MIRT1184045	hsa-miR-4665-3p	CLIP-seq
MIRT1184046	hsa-miR-4667-5p	CLIP-seq
MIRT1184047	hsa-miR-4671-3p	CLIP-seq
MIRT1184048	hsa-miR-4673	CLIP-seq
MIRT1184049	hsa-miR-4695-5p	CLIP-seq
MIRT1184050	hsa-miR-4700-5p	CLIP-seq
MIRT1184051	hsa-miR-4722-5p	CLIP-seq
MIRT1184052	hsa-miR-518a-5p	CLIP-seq
MIRT1184053	hsa-miR-527	CLIP-seq
MIRT1184054	hsa-miR-573	CLIP-seq
MIRT1184055	hsa-miR-608	CLIP-seq
MIRT1184056	hsa-miR-637	CLIP-seq
MIRT1184057	hsa-miR-661	CLIP-seq
MIRT1184058	hsa-miR-676	CLIP-seq
MIRT1184059	hsa-miR-767-5p	CLIP-seq
MIRT1184060	hsa-miR-939	CLIP-seq
MIRT1184046	hsa-miR-4667-5p	CLIP-seq
MIRT1184050	hsa-miR-4700-5p	CLIP-seq
MIRT1184046	hsa-miR-4667-5p	CLIP-seq
MIRT1184050	hsa-miR-4700-5p	CLIP-seq
MIRT2580592	hsa-miR-1321	CLIP-seq
MIRT2580593	hsa-miR-1343	CLIP-seq
MIRT2580594	hsa-miR-155	CLIP-seq
MIRT2580595	hsa-miR-3074-5p	CLIP-seq
MIRT2580596	hsa-miR-3689d	CLIP-seq
MIRT2580597	hsa-miR-4328	CLIP-seq
MIRT2580598	hsa-miR-4739	CLIP-seq
MIRT2580599	hsa-miR-4756-5p	CLIP-seq
MIRT2580600	hsa-miR-541	CLIP-seq
MIRT2580601	hsa-miR-545	CLIP-seq
MIRT2580602	hsa-miR-586	CLIP-seq
MIRT2580603	hsa-miR-654-5p	CLIP-seq
MIRT2580592	hsa-miR-1321	CLIP-seq
MIRT2580593	hsa-miR-1343	CLIP-seq
MIRT2580594	hsa-miR-155	CLIP-seq
MIRT2580595	hsa-miR-3074-5p	CLIP-seq
MIRT2686272	hsa-miR-3192	CLIP-seq
MIRT2580596	hsa-miR-3689d	CLIP-seq
MIRT2686273	hsa-miR-4292	CLIP-seq
MIRT2686274	hsa-miR-4308	CLIP-seq
MIRT2580597	hsa-miR-4328	CLIP-seq
MIRT2580598	hsa-miR-4739	CLIP-seq
MIRT2580599	hsa-miR-4756-5p	CLIP-seq
MIRT2580600	hsa-miR-541	CLIP-seq
MIRT2580601	hsa-miR-545	CLIP-seq
MIRT2686275	hsa-miR-574-5p	CLIP-seq
MIRT2580602	hsa-miR-586	CLIP-seq
MIRT2580603	hsa-miR-654-5p	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	11256944
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11256944
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IDA	15243141
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9332362, 10446203
GO:0005515	Function	Protein binding	IPI	12401788, 15243141, 20936779, 21988832, 23332751, 26496610, 28514442, 32296183, 33961781, 35140242
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15243141, 15964792
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15243141
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	10446203
GO:0006457	Process	Protein folding	TAS	10446203
GO:0016602	Component	CCAAT-binding factor complex	IBA
GO:0016602	Component	CCAAT-binding factor complex	IDA	15243141, 23332751
GO:0016602	Component	CCAAT-binding factor complex	IEA
GO:0016602	Component	CCAAT-binding factor complex	IPI	23332751
GO:0032993	Component	Protein-DNA complex	IDA	11256944
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23332751
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	11256944

MIM	HGNC	e!Ensembl
605344	7806	ENSG00000066136

Protein

UniProt ID

Q13952

Protein name

Nuclear transcription factor Y subunit gamma (CAAT box DNA-binding protein subunit C) (Nuclear transcription factor Y subunit C) (NF-YC) (Transactivator HSM-1/2)

Protein function

Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on

PDB

1N1J , 4AWL , 4CSR , 6QMP , 6QMQ , 6QMS , 7AH8 , 8QU2 , 8QU3 , 8QU4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	9 → 107	Core histone H2A/H2B/H3/H4	Domain

Sequence

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTE
VQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAG
ASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD

Sequence length

458

Interactions

View interactions

	KEGG		Reactome
	Antigen processing and presentation Tuberculosis		PPARA activates gene expression Activation of gene expression by SREBF (SREBP) ATF6 (ATF6-alpha) activates chaperone genes

NFYC (nuclear transcription factor Y subunit gamma)