Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4800
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear transcription factor Y subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NFYA
Synonyms (NCBI Gene) Gene synonyms aliases
CBF-A, CBF-B, HAP2, NF-YA
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021682 hsa-miR-140-3p Sequencing 20371350
MIRT025877 hsa-miR-7-5p Sequencing 20371350
MIRT026722 hsa-miR-192-5p Microarray 19074876
MIRT046947 hsa-miR-221-3p CLASH 23622248
MIRT053441 hsa-miR-203a-3p Microarray 23807165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 11256944
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11256944
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
189903 7804 ENSG00000001167
Protein
UniProt ID P23511
Protein name Nuclear transcription factor Y subunit alpha (CAAT box DNA-binding protein subunit A) (Nuclear transcription factor Y subunit A) (NF-YA)
Protein function Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on
PDB 4AWL , 6QMP , 6QMQ , 6QMS , 8QU2 , 8QU3 , 8QU4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02045 CBFB_NFYA 263 318 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Family
Sequence
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRF
FSPKEKDSPHMQDPNQADEEAMTQIIRVS
Sequence length 347
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Antigen processing and presentation
Spinocerebellar ataxia
Tuberculosis
  PPARA activates gene expression
Activation of gene expression by SREBF (SREBP)
ATF6 (ATF6-alpha) activates chaperone genes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 16271038
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32075093
Alzheimer Disease Associate 38511601
Breast Neoplasms Associate 22285817, 30204945, 31506469, 33271832
Carcinoma Associate 34887475
Carcinoma Hepatocellular Associate 36232701, 36680333
Carcinoma Non Small Cell Lung Associate 25719249
Carcinoma Pancreatic Ductal Associate 30803373
Carcinoma Squamous Cell Associate 31744190
Congenital myasthenic syndrome ib Associate 12393509
Diabetes Mellitus Type 2 Associate 31205951, 32041280