Gene Gene information from NCBI Gene database.
Entrez ID 4800
Gene name Nuclear transcription factor Y subunit alpha
Gene symbol NFYA
Synonyms (NCBI Gene)
CBF-ACBF-BHAP2NF-YA
Chromosome 6
Chromosome location 6p21.1
Summary The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and
miRNA miRNA information provided by mirtarbase database.
891
miRTarBase ID miRNA Experiments Reference
MIRT021682 hsa-miR-140-3p Sequencing 20371350
MIRT025877 hsa-miR-7-5p Sequencing 20371350
MIRT026722 hsa-miR-192-5p Microarray 19074876
MIRT046947 hsa-miR-221-3p CLASH 23622248
MIRT053441 hsa-miR-203a-3p Microarray 23807165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 11256944
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11256944
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
189903 7804 ENSG00000001167
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P23511
Protein name Nuclear transcription factor Y subunit alpha (CAAT box DNA-binding protein subunit A) (Nuclear transcription factor Y subunit A) (NF-YA)
Protein function Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on
PDB 4AWL , 6QMP , 6QMQ , 6QMS , 8QU2 , 8QU3 , 8QU4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02045 CBFB_NFYA 263 318 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Family
Sequence
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRF
FSPKEKDSPHMQDPNQADEEAMTQIIRVS
Sequence length 347
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Antigen processing and presentation
Spinocerebellar ataxia
Tuberculosis
  PPARA activates gene expression
Activation of gene expression by SREBF (SREBP)
ATF6 (ATF6-alpha) activates chaperone genes