NFKBIL1 (NFKB inhibitor like 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4795
Gene name Gene Name - the full gene name approved by the HGNC.
NFKB inhibitor like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NFKBIL1
Synonyms (NCBI Gene) Gene synonyms aliases
IKBL, NFKBIL
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT038896 hsa-miR-93-3p CLASH 23622248
MIRT2053222 hsa-miR-4286 CLIP-seq
MIRT2053223 hsa-miR-4467 CLIP-seq
MIRT2053224 hsa-miR-4519 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20829348, 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 20829348
GO:0005654 Component Nucleoplasm IDA
GO:0005829 Component Cytosol IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
601022 7800 ENSG00000204498
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UBC1
Protein name NF-kappa-B inhibitor-like protein 1 (Inhibitor of kappa B-like protein) (I-kappa-B-like protein) (IkappaBL) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1)
Protein function Involved in the regulation of innate immune response. Acts as negative regulator of Toll-like receptor and interferon-regulatory factor (IRF) signaling pathways. Contributes to the negative regulation of transcriptional activation of NF-kappa-B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13637 Ank_4 65 → 118 Repeat
Tissue specificity TISSUE SPECIFICITY: Detected in different cell types including monocytes, T-cells, B-cells and hepatocytes.
Sequence 
MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLD
VDAGQPPPLHRACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPL
LSRCPSAMGIKNKDGETPGQILGWGPPWDSAEEEEEDDASKEREWRQKLQGELEDEWQEV
MGRFEGDASHETQEPESFSAWSDRLAREHAQKCQQQQREAEGSCRPPRAEGSSQSWRQQE
EEQRLFRERARAKEEELRESRARRAQEALGDREPKPTRAGPREEHPRGAGRGSLWRFGDV
PWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRFRSQIETWELG
RVMGAVTALSQALNRHAEALK
Sequence length 381
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 30054458
Myasthenia gravis Myasthenia Gravis rs5030818, rs121912815, rs121912817, rs121912818, rs121912821, rs75466054, rs121912822, rs121912823, rs794727516, rs764497513, rs376808313, rs1279554995, rs1554802792, rs369251527, rs372760913
View all (8 more)		 26562150
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 21156761, 19503088, 17804836
Vasculitis Vasculitis rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771
View all (6 more)
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma GWAS
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Diabetes Diabetes GWAS
Psoriasis Psoriasis GWAS
Show/Hide Text Mining Associations (18)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 35328735
AIDS Associated Nephropathy Inhibit 24896147, 31936167
AIDS Associated Nephropathy Associate 24896147
Arthritis Rheumatoid Associate 12509789
Barrett Esophagus Associate 35328735
Coronary Aneurysm Associate 35740890
Coronary Restenosis Associate 35740890
COVID 19 Stimulate 35504488
Heart Diseases Associate 20662065
Hemorrhage Associate 24566624