Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4794
Gene name	NFKB inhibitor epsilon
Gene symbol	NFKBIE
Synonyms (NCBI Gene)	IKBE
Chromosome	6
Chromosome location	6p21.1
Summary	The protein encoded by this gene binds to components of NF-kappa-B, trapping the complex in the cytoplasm and preventing it from activating genes in the nucleus. Phosphorylation of the encoded protein targets it for destruction by the ubiquitin pathway, w

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029491	hsa-miR-26b-5p	Microarray	19088304
MIRT036677	hsa-miR-935	CLASH	23622248
MIRT1183556	hsa-miR-1182	CLIP-seq
MIRT1183557	hsa-miR-1287	CLIP-seq
MIRT1183558	hsa-miR-3135b	CLIP-seq
MIRT1183559	hsa-miR-3154	CLIP-seq
MIRT1183560	hsa-miR-3919	CLIP-seq
MIRT1183561	hsa-miR-409-5p	CLIP-seq
MIRT1183562	hsa-miR-412	CLIP-seq
MIRT1183563	hsa-miR-4292	CLIP-seq
MIRT1183564	hsa-miR-4308	CLIP-seq
MIRT1183565	hsa-miR-4438	CLIP-seq
MIRT1183566	hsa-miR-4470	CLIP-seq
MIRT1183567	hsa-miR-4638-3p	CLIP-seq
MIRT2053221	hsa-miR-942	CLIP-seq
MIRT2282495	hsa-miR-103b	CLIP-seq
MIRT2282496	hsa-miR-1184	CLIP-seq
MIRT2282497	hsa-miR-1185	CLIP-seq
MIRT2282498	hsa-miR-1233	CLIP-seq
MIRT2282499	hsa-miR-125a-5p	CLIP-seq
MIRT2282500	hsa-miR-125b	CLIP-seq
MIRT2282501	hsa-miR-2355-5p	CLIP-seq
MIRT2282502	hsa-miR-296-5p	CLIP-seq
MIRT2282503	hsa-miR-3136-3p	CLIP-seq
MIRT2282504	hsa-miR-3605-5p	CLIP-seq
MIRT2282505	hsa-miR-3679-5p	CLIP-seq
MIRT2282506	hsa-miR-4293	CLIP-seq
MIRT2282507	hsa-miR-4319	CLIP-seq
MIRT2282508	hsa-miR-4418	CLIP-seq
MIRT2282509	hsa-miR-4436b-3p	CLIP-seq
MIRT2282510	hsa-miR-4661-3p	CLIP-seq
MIRT2282511	hsa-miR-4761-3p	CLIP-seq
MIRT2282512	hsa-miR-509-3-5p	CLIP-seq
MIRT2282513	hsa-miR-509-5p	CLIP-seq
MIRT2282514	hsa-miR-544b	CLIP-seq
MIRT2282515	hsa-miR-596	CLIP-seq
MIRT2282516	hsa-miR-661	CLIP-seq
MIRT2455115	hsa-miR-3155	CLIP-seq
MIRT2455116	hsa-miR-3155b	CLIP-seq
MIRT2455117	hsa-miR-3176	CLIP-seq
MIRT2455118	hsa-miR-3922-3p	CLIP-seq
MIRT2455119	hsa-miR-4701-5p	CLIP-seq
MIRT2455120	hsa-miR-484	CLIP-seq
MIRT2455121	hsa-miR-588	CLIP-seq
MIRT2455122	hsa-miR-760	CLIP-seq
MIRT2686247	hsa-miR-1236	CLIP-seq
MIRT2686248	hsa-miR-1470	CLIP-seq
MIRT2686249	hsa-miR-193a-3p	CLIP-seq
MIRT2686250	hsa-miR-193b	CLIP-seq
MIRT2686251	hsa-miR-2114	CLIP-seq
MIRT2686252	hsa-miR-24	CLIP-seq
MIRT2686253	hsa-miR-3064-5p	CLIP-seq
MIRT2455115	hsa-miR-3155	CLIP-seq
MIRT2455116	hsa-miR-3155b	CLIP-seq
MIRT2686254	hsa-miR-3169	CLIP-seq
MIRT2455117	hsa-miR-3176	CLIP-seq
MIRT2686255	hsa-miR-3652	CLIP-seq
MIRT2686256	hsa-miR-3664-3p	CLIP-seq
MIRT2455118	hsa-miR-3922-3p	CLIP-seq
MIRT2686257	hsa-miR-4274	CLIP-seq
MIRT2686258	hsa-miR-4430	CLIP-seq
MIRT2686259	hsa-miR-4436a	CLIP-seq
MIRT2686260	hsa-miR-4436b-5p	CLIP-seq
MIRT2686261	hsa-miR-4505	CLIP-seq
MIRT2686262	hsa-miR-4638-5p	CLIP-seq
MIRT2686263	hsa-miR-4667-3p	CLIP-seq
MIRT2455119	hsa-miR-4701-5p	CLIP-seq
MIRT2455120	hsa-miR-484	CLIP-seq
MIRT2455121	hsa-miR-588	CLIP-seq
MIRT2455122	hsa-miR-760	CLIP-seq
MIRT2686264	hsa-miR-892b	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	14743216, 16769727, 21988832, 28514442, 33961781, 35271311, 37643469
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9135156
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0140311	Function	Protein sequestering activity	IDA	9135156

MIM	HGNC	e!Ensembl
604548	7799	ENSG00000146232

O00221

Protein name

NF-kappa-B inhibitor epsilon (NF-kappa-BIE) (I-kappa-B-epsilon) (IkB-E) (IkB-epsilon) (IkappaBepsilon)

Protein function

Sequesters NF-kappa-B transcription factor complexes in the cytoplasm, thereby inhibiting their activity (PubMed:9315679). Sequestered complexes include NFKB1-RELA (p50-p65) and NFKB1-REL (p50-c-Rel) complexes (PubMed:9135156, PubMed:9315679). L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00023	Ank	403 → 434	Ankyrin repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, testis and lung, followed by kidney, pancreas, heart, placenta and brain. Also expressed in granulocytes and macrophages.

Sequence

MNQRRSESRPGNHRLQAYAEPGKGDSGGAGPLSGSARRGRGGGGAIRVRRPCWSGGAGRG
GGPAWAVRLPTVTAGWTWPALRTLSSLRAGPSEPHSPGRRPPRAGRPLCQADPQPGKAAR
RSLEPDPAQTGPRPARAAGMSEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPS
DGSPQPCTHPPGPVKEPQEKEDADGERADSTYGSSSLTYTLSLLGGPEAEDPAPRLPLPH
VGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHL
AVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTSHS
LDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLV
QFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
LVLLPFDDLKISGKLLLCTD

Sequence length

500

Interactions

View interactions

	KEGG		Reactome
	Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway B cell receptor signaling pathway Neurotrophin signaling pathway Adipocytokine signaling pathway Epstein-Barr virus infection PD-L1 expression and PD-1 checkpoint pathway in cancer		Activation of NF-kappaB in B cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	23028356, 23577190, 26587663, 26686423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Associate	35720300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	27670424, 32079702	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	28542447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	22675518, 25987724, 27670424, 36566271	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	26686423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	27670424	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	25987724, 27670424	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	27670424, 36215154	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	32961552	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	26343386	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningitis Pneumococcal	Associate	26870821	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	29857068	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	15298715	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	24631628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	26686423	★★★★★ ★☆☆☆☆ Found in Text Mining only

NFKBIE (NFKB inhibitor epsilon)