Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4790
Gene name Gene Name - the full gene name approved by the HGNC.	Nuclear factor kappa B subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NFKB1
Synonyms (NCBI Gene) Gene synonyms aliases	CVID12, EBP-1, KBF1, NF-kB, NF-kB1, NF-kappa-B1, NF-kappaB, NF-kappabeta, NFKB-p105, NFKB-p50, NFkappaB
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q24
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF

Show/Hide all(25)

SNP ID	Visualize variation	Clinical significance	Consequence
rs773694113	->T	Pathogenic, likely-pathogenic	Coding sequence variant, frameshift variant
rs869320688	A>G	Pathogenic	Intron variant
rs869320689	T>C,G	Likely-pathogenic, pathogenic	Splice donor variant
rs869320754	->A	Pathogenic	Frameshift variant, coding sequence variant
rs939459600	C>G,T	Likely-pathogenic	Missense variant, stop gained, coding sequence variant
rs1553934187	C>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant
rs1553934395	G>A	Likely-pathogenic	Splice donor variant
rs1560679469	->A	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1560706306	->A	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1578735709	G>A	Likely-pathogenic	Splice acceptor variant
rs1578735747	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1578771120	T>G	Pathogenic	Coding sequence variant, missense variant
rs1578771197	T>A	Pathogenic	Coding sequence variant, missense variant
rs1578771211	C>T	Pathogenic	Coding sequence variant, stop gained
rs1578785260	->A	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1578787945	A>-	Likely-pathogenic	Coding sequence variant, intron variant, frameshift variant
rs1578790573	->A	Likely-pathogenic, pathogenic	Coding sequence variant, frameshift variant
rs1578793298	C>G	Pathogenic	Coding sequence variant, missense variant
rs1578793312	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, stop gained
rs1578795536	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1578805410	AGAA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1578809017	->AG	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1578809101	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1578811073	TGCCA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1578811245	GA>-	Pathogenic	Coding sequence variant, stop gained

Show/Hide all(191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003193	hsa-miR-9-5p	qRT-PCR, Luciferase reporter assay, Western blot	19702828
MIRT004459	hsa-miR-146a-5p	Luciferase reporter assay	18504431
MIRT004530	hsa-miR-146b-5p	Luciferase reporter assay	18504431
MIRT003193	hsa-miR-9-5p	Luciferase reporter assay	19702828
MIRT003193	hsa-miR-9-5p	GFP reporter assay, qRT-PCR, Western blot	20102618
MIRT003193	hsa-miR-9-5p	GFP reporter assay, qRT-PCR, Western blot	20102618
MIRT004459	hsa-miR-146a-5p	qRT-PCR, Western blot	20124483
MIRT004829	hsa-miR-15a-5p	Microarray, qRT-PCR	17260024
MIRT004830	hsa-let-7a-5p	Microarray, qRT-PCR	17260024
MIRT003193	hsa-miR-9-5p	GFP reporter assay, Western blot	22131135
MIRT003193	hsa-miR-9-5p	WM115A	22131135
MIRT003193	hsa-miR-9-5p	GFP reporter assay, Western blot	22131135
MIRT003193	hsa-miR-9-5p	WM115A	22131135
MIRT006528	hsa-miR-16-5p	ChIP-seq	21081469
MIRT006528	hsa-miR-16-5p	ChIP-seq	21081469
MIRT006529	hsa-miR-21-5p	ChIP-seq	21081469
MIRT006529	hsa-miR-21-5p	ChIP-seq	21081469
MIRT003193	hsa-miR-9-5p	GFP reporter assay, Western blot	22131135
MIRT003193	hsa-miR-9-5p	WM115A	22131135
MIRT006528	hsa-miR-16-5p	ChIP-seq	21081469
MIRT006528	hsa-miR-16-5p	ChIP-seq	21081469
MIRT006529	hsa-miR-21-5p	ChIP-seq	21081469
MIRT006529	hsa-miR-21-5p	ChIP-seq	21081469
MIRT006938	mmu-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	22575656
MIRT006938	mmu-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	22575656
MIRT006938	mmu-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	22575656
MIRT021048	hsa-miR-155-5p	Proteomics	21030878
MIRT004459	hsa-miR-146a-5p	Microarray	18660546
MIRT003193	hsa-miR-9-5p	Reporter assay;Western blot	19289835
MIRT030242	hsa-miR-26b-5p	Microarray	19088304
MIRT049105	hsa-miR-92a-3p	CLASH	23622248
MIRT003193	hsa-miR-9-5p	GFP reporter assay, qRT-PCR, Western blot	22825752
MIRT003193	hsa-miR-9-5p	GFP reporter assay, qRT-PCR, Western blot	22825752
MIRT004459	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23706078
MIRT438493	hsa-miR-139-5p	Luciferase reporter assay	24158791
MIRT004459	hsa-miR-146a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23706078
MIRT438174	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24299514
MIRT438174	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24299514
MIRT438493	hsa-miR-139-5p	Luciferase reporter assay	24158791
MIRT004459	hsa-miR-146a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23706078
MIRT438174	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24299514
MIRT438174	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24299514
MIRT210911	hsa-miR-508-3p	Luciferase reporter assay, Western blot	26801246
MIRT210911	hsa-miR-508-3p	Luciferase reporter assay, Western blot	26801246
MIRT003193	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27603333
MIRT003193	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26248136
MIRT003193	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26248136
MIRT021048	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT021048	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT021048	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT021048	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT210911	hsa-miR-508-3p	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26801246
MIRT210911	hsa-miR-508-3p	ChIP-seq, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26801246
MIRT004459	hsa-miR-146a-5p	ELISA, Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	25052989
MIRT004459	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT021048	hsa-miR-155-5p	qRT-PCR	31739406
MIRT736432	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT737048	hsa-miR-375	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31802830
MIRT737048	hsa-miR-375	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31802830
MIRT737048	hsa-miR-375	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31802830
MIRT755528	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR	36250208
MIRT755718	hsa-miR-3976	Luciferase reporter assay, Western blotting, qRT-PCR	37427366
MIRT1183404	hsa-miR-1252	CLIP-seq
MIRT1183405	hsa-miR-1273	CLIP-seq
MIRT1183406	hsa-miR-3675-3p	CLIP-seq
MIRT1183407	hsa-miR-4753-3p	CLIP-seq
MIRT1183408	hsa-miR-4755-3p	CLIP-seq
MIRT1183409	hsa-miR-4775	CLIP-seq
MIRT1183410	hsa-miR-1179	CLIP-seq
MIRT1183411	hsa-miR-1207-3p	CLIP-seq
MIRT1183412	hsa-miR-1296	CLIP-seq
MIRT1183413	hsa-miR-15a	CLIP-seq
MIRT1183414	hsa-miR-15b	CLIP-seq
MIRT1183415	hsa-miR-16	CLIP-seq
MIRT1183416	hsa-miR-195	CLIP-seq
MIRT1183417	hsa-miR-2909	CLIP-seq
MIRT1183418	hsa-miR-299-5p	CLIP-seq
MIRT1183419	hsa-miR-3120-5p	CLIP-seq
MIRT1183420	hsa-miR-3128	CLIP-seq
MIRT1183421	hsa-miR-3138	CLIP-seq
MIRT1183422	hsa-miR-3153	CLIP-seq
MIRT1183423	hsa-miR-3158-3p	CLIP-seq
MIRT1183424	hsa-miR-3182	CLIP-seq
MIRT1183425	hsa-miR-338-3p	CLIP-seq
MIRT1183406	hsa-miR-3675-3p	CLIP-seq
MIRT1183426	hsa-miR-424	CLIP-seq
MIRT1183427	hsa-miR-431	CLIP-seq
MIRT1183428	hsa-miR-4446-3p	CLIP-seq
MIRT1183429	hsa-miR-4470	CLIP-seq
MIRT1183430	hsa-miR-4480	CLIP-seq
MIRT1183431	hsa-miR-4522	CLIP-seq
MIRT1183432	hsa-miR-4530	CLIP-seq
MIRT1183433	hsa-miR-4648	CLIP-seq
MIRT1183434	hsa-miR-4654	CLIP-seq
MIRT1183435	hsa-miR-4668-5p	CLIP-seq
MIRT1183436	hsa-miR-4729	CLIP-seq
MIRT1183437	hsa-miR-4752	CLIP-seq
MIRT1183407	hsa-miR-4753-3p	CLIP-seq
MIRT1183438	hsa-miR-4769-5p	CLIP-seq
MIRT1183439	hsa-miR-4786-3p	CLIP-seq
MIRT1183440	hsa-miR-4800-5p	CLIP-seq
MIRT1183441	hsa-miR-497	CLIP-seq
MIRT1183442	hsa-miR-548a-5p	CLIP-seq
MIRT1183443	hsa-miR-548ab	CLIP-seq
MIRT1183444	hsa-miR-548ak	CLIP-seq
MIRT1183445	hsa-miR-548b-5p	CLIP-seq
MIRT1183446	hsa-miR-548c-5p	CLIP-seq
MIRT1183447	hsa-miR-548d-5p	CLIP-seq
MIRT1183448	hsa-miR-548h	CLIP-seq
MIRT1183449	hsa-miR-548i	CLIP-seq
MIRT1183450	hsa-miR-548j	CLIP-seq
MIRT1183451	hsa-miR-548n	CLIP-seq
MIRT1183452	hsa-miR-548t	CLIP-seq
MIRT1183453	hsa-miR-548w	CLIP-seq
MIRT1183454	hsa-miR-548y	CLIP-seq
MIRT1183455	hsa-miR-559	CLIP-seq
MIRT1183456	hsa-miR-581	CLIP-seq
MIRT1183457	hsa-miR-590-3p	CLIP-seq
MIRT1183458	hsa-miR-602	CLIP-seq
MIRT1183459	hsa-miR-640	CLIP-seq
MIRT1183460	hsa-miR-646	CLIP-seq
MIRT1183461	hsa-miR-659	CLIP-seq
MIRT1183462	hsa-miR-671-5p	CLIP-seq
MIRT1183463	hsa-miR-9	CLIP-seq
MIRT2053176	hsa-miR-549	CLIP-seq
MIRT1183459	hsa-miR-640	CLIP-seq
MIRT1183460	hsa-miR-646	CLIP-seq
MIRT2282466	hsa-miR-1322	CLIP-seq
MIRT2282467	hsa-miR-3662	CLIP-seq
MIRT1183404	hsa-miR-1252	CLIP-seq
MIRT2282466	hsa-miR-1322	CLIP-seq
MIRT2282467	hsa-miR-3662	CLIP-seq
MIRT1183411	hsa-miR-1207-3p	CLIP-seq
MIRT1183404	hsa-miR-1252	CLIP-seq
MIRT1183405	hsa-miR-1273	CLIP-seq
MIRT2282466	hsa-miR-1322	CLIP-seq
MIRT1183413	hsa-miR-15a	CLIP-seq
MIRT1183414	hsa-miR-15b	CLIP-seq
MIRT1183415	hsa-miR-16	CLIP-seq
MIRT1183416	hsa-miR-195	CLIP-seq
MIRT2580501	hsa-miR-199b-5p	CLIP-seq
MIRT2580502	hsa-miR-2355-5p	CLIP-seq
MIRT2580503	hsa-miR-2467-3p	CLIP-seq
MIRT2580504	hsa-miR-3120-3p	CLIP-seq
MIRT2580505	hsa-miR-3126-5p	CLIP-seq
MIRT1183420	hsa-miR-3128	CLIP-seq
MIRT2580506	hsa-miR-3157-5p	CLIP-seq
MIRT2580507	hsa-miR-324-5p	CLIP-seq
MIRT1183425	hsa-miR-338-3p	CLIP-seq
MIRT2282467	hsa-miR-3662	CLIP-seq
MIRT1183406	hsa-miR-3675-3p	CLIP-seq
MIRT2580508	hsa-miR-3914	CLIP-seq
MIRT1183426	hsa-miR-424	CLIP-seq
MIRT1183429	hsa-miR-4470	CLIP-seq
MIRT1183432	hsa-miR-4530	CLIP-seq
MIRT2580509	hsa-miR-4676-5p	CLIP-seq
MIRT2580510	hsa-miR-4679	CLIP-seq
MIRT2580511	hsa-miR-4691-3p	CLIP-seq
MIRT2580512	hsa-miR-4698	CLIP-seq
MIRT1183407	hsa-miR-4753-3p	CLIP-seq
MIRT1183408	hsa-miR-4755-3p	CLIP-seq
MIRT1183409	hsa-miR-4775	CLIP-seq
MIRT1183441	hsa-miR-497	CLIP-seq
MIRT2053176	hsa-miR-549	CLIP-seq
MIRT2580513	hsa-miR-572	CLIP-seq
MIRT2580514	hsa-miR-575	CLIP-seq
MIRT1183459	hsa-miR-640	CLIP-seq
MIRT1183460	hsa-miR-646	CLIP-seq
MIRT1183411	hsa-miR-1207-3p	CLIP-seq
MIRT1183413	hsa-miR-15a	CLIP-seq
MIRT1183414	hsa-miR-15b	CLIP-seq
MIRT1183415	hsa-miR-16	CLIP-seq
MIRT1183416	hsa-miR-195	CLIP-seq
MIRT2580501	hsa-miR-199b-5p	CLIP-seq
MIRT2580502	hsa-miR-2355-5p	CLIP-seq
MIRT1183420	hsa-miR-3128	CLIP-seq
MIRT2580506	hsa-miR-3157-5p	CLIP-seq
MIRT2580507	hsa-miR-324-5p	CLIP-seq
MIRT1183425	hsa-miR-338-3p	CLIP-seq
MIRT1183426	hsa-miR-424	CLIP-seq
MIRT1183429	hsa-miR-4470	CLIP-seq
MIRT1183432	hsa-miR-4530	CLIP-seq
MIRT2580509	hsa-miR-4676-5p	CLIP-seq
MIRT2580510	hsa-miR-4679	CLIP-seq
MIRT2580511	hsa-miR-4691-3p	CLIP-seq
MIRT1183441	hsa-miR-497	CLIP-seq
MIRT2053176	hsa-miR-549	CLIP-seq
MIRT2580513	hsa-miR-572	CLIP-seq
MIRT2580514	hsa-miR-575	CLIP-seq
MIRT1183459	hsa-miR-640	CLIP-seq
MIRT1183460	hsa-miR-646	CLIP-seq

Transcription factors

Show/Hide all(41)

Transcription factor	Regulation	Reference
APEX1	Activation	17045925
AR	Repression	18386814
BCL3	Repression	11387332
BCL3	Unknown	14573596;7896265
BCL6	Repression	15611242
BTF3	Repression	17312387
EGR1	Unknown	10671503
EP300	Unknown	9560267
ETV3	Repression	18025162
FHL2	Unknown	18752053
FOS	Repression	20188076
GATA3	Unknown	19686049
HDAC1	Unknown	24448807
HDAC9	Repression	15964798
HOXA9	Repression	18068911
HSF1	Unknown	18689673
LYL1	Repression	10023675
NFKB1	Unknown	19469019
NFKBIA	Activation	9500973
NFKBIA	Repression	11278471;18606063;20173029
NFKBIA	Unknown	15713458;17148610
NR1H4	Activation	21364590
NR1I2	Repression	22248096
NR3C1	Repression	17016446
PARP1	Unknown	16026317
PIR	Unknown	14573596
RBPJ	Unknown	14570916
RELA	Activation	20596645
RELA	Unknown	19469019
RUNX1	Unknown	19686049
SP1	Activation	20538607;9151857
SP3	Activation	20538607
SP4	Activation	20538607
SRSF1	Repression	19183244
TAL1	Repression	16778171
TNFAIP3	Repression	19124729
TNFAIP3	Unknown	24039598
TP53	Unknown	15988033
TRIM22	Unknown	21651891
USF1	Unknown	19686049
ZNF382	Repression	20682794

Show/Hide all(109)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	24434150
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19881551
GO:0000165	Process	MAPK cascade	IDA	1833717
GO:0000165	Process	MAPK cascade	IEA
GO:0000785	Component	Chromatin	IC	34721373
GO:0000785	Component	Chromatin	IDA	8413223
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	16938301, 17426251, 18718911
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	7959007
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	1406630, 23811396
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	26801246
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	17426251
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	26801246
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	IPI	23811396
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	24434510
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	1406630, 23811396, 34721373
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16938301
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8413223, 17426251
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	7651415, 8196632, 8246997, 8441377, 9865693, 10023675, 10498867, 11297557, 11526476, 11931769, 12482991, 12832462, 14624448, 14743216, 15169888, 15799966, 16108830, 16306601, 16319921, 17003112, 18045535, 18212740, 19350539, 19358846, 20195357, 20237821, 20547752, 21270162, 21483817
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	11819787, 16938301, 25411248
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IGI	23729669
GO:0005634	Component	Nucleus	TAS	1992489
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	11819787
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IGI	23729669
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	34721373
GO:0006366	Process	Transcription by RNA polymerase II	TAS	1992489
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IDA	10748004
GO:0006954	Process	Inflammatory response	TAS	1992489
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	23811396, 34721373
GO:0007254	Process	JNK cascade	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	26687115
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IGI	16938301
GO:0010875	Process	Positive regulation of cholesterol efflux	IGI	16938301
GO:0010884	Process	Positive regulation of lipid storage	IGI	16938301
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IDA	15243130
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	34721373
GO:0032695	Process	Negative regulation of interleukin-12 production	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	20237821
GO:0033256	Component	I-kappaB/NF-kappaB complex	IEA
GO:0033256	Component	I-kappaB/NF-kappaB complex	IGI	16938301
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035525	Component	NF-kappaB p50/p65 complex	IBA
GO:0035525	Component	NF-kappaB p50/p65 complex	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0035994	Process	Response to muscle stretch	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	8413223
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	12482991, 12832462, 21988832, 25609649
GO:0042805	Function	Actinin binding	IPI	25411248
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10811897
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	17426251
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20018240
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	8096091
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	1406630, 23811396
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	16938301
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19955433
GO:0050728	Process	Negative regulation of inflammatory response	IDA	16424369
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	16424369
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0060056	Process	Mammary gland involution	IEA
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	23776175
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071316	Process	Cellular response to nicotine	IMP	22357537
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071354	Process	Cellular response to interleukin-6	IMP	22357537
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071359	Process	Cellular response to dsRNA	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	20018240
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0140311	Function	Protein sequestering activity	ISS
GO:0140367	Process	Antibacterial innate immune response	IDA	20406817
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:1900127	Process	Positive regulation of hyaluronan biosynthetic process	IDA	17324121
GO:1904385	Process	Cellular response to angiotensin	IMP	22357537
GO:2000630	Process	Positive regulation of miRNA metabolic process	IMP	22357537

MIM	HGNC	e!Ensembl
164011	7794	ENSG00000109320

Protein

UniProt ID

P19838

Protein name

Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit]

Protein function

NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammati

PDB

1MDI , 1MDJ , 1MDK , 1NFI , 1SVC , 2DBF , 2O61 , 3GUT , 7LEQ , 7LET , 7LF4 , 7LFC , 7RG4 , 7RG5 , 8TQD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00554	RHD_DNA_bind	44 → 242	Rel homology DNA-binding domain	Domain
PF16179	RHD_dimer	251 → 353	Rel homology dimerisation domain	Domain
PF00023	Ank	583 → 613	Ankyrin repeat	Repeat
PF12796	Ank_2	679 → 749	Ankyrin repeats (3 copies)	Repeat
PF00531	Death	816 → 892	Death domain	Domain

Sequence

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI

Sequence length

968

Interactions

View interactions

	KEGG		Reactome
	Antifolate resistance MAPK signaling pathway Ras signaling pathway cAMP signaling pathway Chemokine signaling pathway NF-kappa B signaling pathway HIF-1 signaling pathway Sphingolipid signaling pathway PI3K-Akt signaling pathway Apoptosis Longevity regulating pathway Cellular senescence Osteoclast differentiation Neutrophil extracellular trap formation Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway C-type lectin receptor signaling pathway IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway B cell receptor signaling pathway TNF signaling pathway Neurotrophin signaling pathway Prolactin signaling pathway Adipocytokine signaling pathway Relaxin signaling pathway Insulin resistance Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Alcoholic liver disease Alzheimer disease Pathways of neurodegeneration - multiple diseases Cocaine addiction Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Legionellosis Yersinia infection Leishmaniasis Chagas disease Toxoplasmosis Amoebiasis Tuberculosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Pathways in cancer Transcriptional misregulation in cancer Viral carcinogenesis MicroRNAs in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Pancreatic cancer Prostate cancer Chronic myeloid leukemia Acute myeloid leukemia Small cell lung cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Inflammatory bowel disease Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		Activation of NF-kappaB in B cells RIP-mediated NFkB activation via ZBP1 Regulated proteolysis of p75NTR Downstream TCR signaling NF-kB is activated and signals survival Senescence-Associated Secretory Phenotype (SASP) FCERI mediated NF-kB activation DEx/H-box helicases activate type I IFN and inflammatory cytokines production PKMTs methylate histone lysines TAK1 activates NFkB by phosphorylation and activation of IKKs complex Interleukin-1 processing IkBA variant leads to EDA-ID CLEC7A (Dectin-1) signaling CD209 (DC-SIGN) signaling CLEC7A/inflammasome pathway MAP3K8 (TPL2)-dependent MAPK1/3 activation Neutrophil degranulation The NLRP3 inflammasome Transcriptional Regulation by VENTX Interleukin-1 signaling TRAF6 mediated NF-kB activation HCMV Early Events Purinergic signaling in leishmaniasis infection

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Common Variable Immunodeficiency	immunodeficiency, common variable, 12, common variable immunodeficiency	rs939459600, rs1578809101, rs869320688, rs1578771120, rs869320689, rs1578811073, rs869320754, rs1578771197, rs773694113, rs1578793298, rs1723945421, rs1560679469, rs1578793312, rs1560711146, rs1578790573	N/A
Immunodeficiency	Inherited Immunodeficiency Diseases	rs1578795536, rs869320689, rs1578735747, rs1578809101, rs1578811073, rs1578811245, rs1578771211, rs1578735709, rs773694113, rs1578793312	N/A

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Allergic Sensitization	Allergic sensitization	N/A	N/A	GWAS
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS
Biliary Cirrhosis	Primary biliary cirrhosis	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (940)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abdominal Injuries	Associate	23671649
Abnormalities Drug Induced	Associate	11676830
Abortion Habitual	Associate	36369952
Abortion Spontaneous	Associate	29796818
Achalasia Addisonianism Alacrimia syndrome	Associate	31597263
Acidemia isovaleric	Associate	27391542
Acidosis	Associate	23613998
Acidosis	Stimulate	25504433
Acidosis Renal Tubular	Associate	33125105
Acne Vulgaris	Associate	25894228
Acquired Immunodeficiency Syndrome	Associate	21792887
Acro Osteolysis	Associate	21472776
Acrospiroma	Associate	31101826
Acute Coronary Syndrome	Associate	22997483, 23671649, 30910844
Acute Coronary Syndrome	Stimulate	24524679
Acute Disease	Stimulate	31756302
Acute erythroleukemia	Associate	33878036
Acute Kidney Injury	Associate	24607031, 28898406, 30429237, 33505213, 34240756, 34730059, 34975885, 35491874, 36594097, 38220171
Acute Kidney Injury	Stimulate	34027766
Acute Lung Injury	Associate	17592547, 35549905, 9153285
Acute Lung Injury	Stimulate	33757467, 35933468
Adams Stokes Syndrome	Associate	14641910
Addison Disease	Associate	31803180
Adenocarcinoma	Associate	15024310, 15256061, 16278667, 17220207, 24692067, 29473241, 30075033, 33925297, 38000688
Adenocarcinoma	Stimulate	15484295, 39337548
Adenocarcinoma Mucinous	Associate	19448592
Adenocarcinoma of Lung	Associate	10092592, 16109772, 23593434, 24487386, 25820700, 26531258, 29750426, 29788922, 29927028, 31541631, 32179851, 32439898, 32678313, 35135563, 35379924 View all (8 more)
Adenoma	Associate	16565384, 19925668, 23977225, 34681684, 36198850
Adenomyosis	Associate	23706331
Agammaglobulinemia	Associate	32278790, 32813180, 33995346, 35003082, 36356849
Aggressive Periodontitis	Associate	28662328
AIDS Associated Nephropathy	Associate	26079546
AIDS Dementia Complex	Associate	8477851
Airway Remodeling	Associate	34939316
Alcoholic Intoxication	Inhibit	17895971
Alcoholism	Associate	17895971, 34415075, 36577732
Allergic Fungal Sinusitis	Associate	23709377, 26521790
Alzheimer Disease	Associate	18801740, 20937840, 21329555, 23186989, 24812571, 27997051, 29343717, 30124448, 30478411, 32980851, 33633844, 35129804, 36042609, 37009506, 39183433
Alzheimer Disease	Stimulate	22255598
Amyotrophic Lateral Sclerosis	Associate	21408173, 24690380, 26785371, 27512062, 27552911, 35361972
Amyotrophic lateral sclerosis 1	Stimulate	12437573
Amyotrophic lateral sclerosis 1	Associate	27075172
Anemia Aplastic	Associate	28764810, 32972988
Anemia Diamond Blackfan	Associate	29745857
Anemia Sickle Cell	Stimulate	11001897, 24551209
Anemia Sickle Cell	Associate	19251437
Aneurysm	Associate	23768831, 31147528
Aneurysm Ascending Aorta	Associate	34648622
Angina Unstable	Associate	35942210
Ankle Fractures	Associate	30237391
Anodontia	Associate	11313274, 33943035
Anodontia	Stimulate	14534291, 16042757
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	37931331
Antiphospholipid Syndrome	Associate	16385547, 22288586
Aortic Aneurysm	Associate	28198528
Aortic Aneurysm Abdominal	Associate	20031636, 22694979, 33415145
Aortic Aneurysm Abdominal	Stimulate	20488324
Aortic Aneurysm Thoracic	Associate	36555139
Aortic Diseases	Associate	35229558
Aortic Valve Stenosis	Associate	34494136
Appendiceal Neoplasms	Associate	19448592
Arthritis	Associate	12209522, 15828019, 22549135, 25578529, 33060686
Arthritis Gouty	Associate	39259129
Arthritis Infectious	Associate	20740673
Arthritis Juvenile	Associate	29409136, 31958219
Arthritis Psoriatic	Associate	10857783, 16519819, 24587411, 35095831, 35507331, 39509434
Arthritis Psoriatic	Stimulate	15955104
Arthritis Rheumatoid	Associate	10070274, 11297551, 11406522, 11477102, 11598150, 11822409, 15142264, 15498798, 15743888, 16385502, 16519794, 16519819, 16646028, 16736517, 16803639 View all (69 more)
Arthritis Rheumatoid	Inhibit	16427328
Arthritis Rheumatoid	Stimulate	24971370, 27629845
Arthropathy progressive pseudorheumatoid of childhood	Stimulate	28137267
Ascites	Associate	32390009
Ascites	Stimulate	34951138
Asphyxia	Associate	12699414
Asthma	Associate	14764095, 15723090, 16519819, 19610265, 20006706, 23126502, 23690573, 24993907, 25055998, 25380286, 26466682, 27504716, 31803180, 33510050, 33691249 View all (5 more)
Astrocytoma	Associate	11381677, 18327814, 19775294, 25659096, 26682910
Ataxia Telangiectasia	Associate	32554850, 35619700
Ataxia Telangiectasia	Stimulate	35212385
Atherosclerosis	Associate	10206970, 10892347, 11104691, 11120850, 15064395, 15585759, 16141529, 16177180, 16269654, 16573830, 16914532, 20404041, 20418897, 21418223, 21496279 View all (19 more)
Atrial Fibrillation	Associate	18375832
Atrial Fibrillation	Stimulate	19169931, 29595637
Autism Spectrum Disorder	Associate	21935439, 28808521, 32677958, 35422816
Autoimmune Diseases	Associate	10572100, 11433385, 22990857, 23448136, 23824834, 23944604, 24386391, 25640675, 26062845, 26733199, 27609421, 28715461, 29963038, 32879140, 35449863 View all (6 more)
Autoimmune Diseases	Stimulate	21525354
Autoimmune Diseases of the Nervous System	Associate	27232500
Axial Spondyloarthritis	Stimulate	26671920
Bacterial Infections	Associate	33037203
Barrett Esophagus	Associate	15024310, 16682957, 17403674, 19147583, 24852569, 28442495, 29473241
Basal Ganglia Diseases	Associate	15093542
Behcet Syndrome	Associate	15986355, 25367031, 26784953, 35941595, 36333776, 37264476
Bicuspid Aortic Valve Disease	Associate	34648622
Bile Reflux	Associate	29911313
Biliary Atresia	Associate	29070776
Bipolar Disorder	Associate	24143878, 27759212, 33436571, 36462601, 36463340
Bipolar Disorder	Inhibit	25740047, 36303132
Blast Injuries	Associate	28323898
Blau syndrome	Associate	12626759, 15459013, 19116920, 20039400, 36192768
Blister	Associate	8757764
Blood Coagulation Disorders	Associate	33633307, 34494136, 37605849
Blood Platelet Disorders	Associate	24730061
Bohring syndrome	Associate	26871511
Bone Diseases	Associate	16497877, 16736517, 33483588
Bone Diseases Metabolic	Associate	25565391
Bone Marrow Failure Disorders	Associate	18055871, 28764810
Brachydactyly Type D	Stimulate	28504607
Brain Death	Associate	26647763
Brain Diseases	Associate	22805531
Brain Injuries Traumatic	Associate	37801989
Brain Neoplasms	Associate	21364648, 33864076, 33991013, 36007522
Breast Neoplasms	Associate	10373501, 11359788, 11689575, 12398896, 12771144, 15044447, 15087380, 15220474, 17189385, 17407600, 17574021, 17670913, 17890907, 18242184, 18283314 View all (186 more)
Breast Neoplasms	Stimulate	16571274, 28629477, 32239615, 32277626, 9618523
Breast Neoplasms	Inhibit	17227585, 18546262, 19307053, 26835711, 40666524
Breast Neoplasms Male	Associate	19442295
Bronchiolitis	Associate	26541527, 29244796
Bronchiolitis Obliterans	Associate	35550018
Bronchiolitis Obliterans Syndrome	Associate	22025895, 25828101
Bronchopneumonia	Associate	33719773
Bronchopulmonary Dysplasia	Associate	16049063, 29644893, 39807735
Bronchopulmonary Dysplasia	Stimulate	17592547
Burkitt Lymphoma	Associate	11799186, 15498850, 15755279, 15979856, 18550789, 19018532, 21792887, 23237561, 23603894, 31719683, 7969136
Burkitt Lymphoma	Inhibit	21856773
Burns	Inhibit	22079905
Burns	Associate	25844669
Cachexia	Associate	15170030, 19857958, 26053616, 34630405
Calcinosis	Associate	23416929, 25407893, 26515875, 27441657, 29227975, 36958298
Calcinosis Cutis	Stimulate	11775058
Calcinosis Cutis	Associate	20414006, 21765477, 32701605
Candidiasis familial chronic mucocutaneous autosomal recessive	Inhibit	30429846
Cap Myopathy	Associate	24518599
Carcinogenesis	Associate	10049353, 10207072, 10637284, 10788437, 12063265, 12398896, 12913277, 14679213, 14711835, 14716817, 15016316, 15184909, 15265936, 15484295, 15498850 View all (87 more)
Carcinoma	Associate	18719365
Carcinoma	Stimulate	23659359
Carcinoma Adenoid Cystic	Associate	16900776, 19317804
Carcinoma Basal Cell	Associate	23690997, 30178853
Carcinoma Ductal	Associate	30760857
Carcinoma Hepatocellular	Associate	11819787, 12365017, 12909638, 14530285, 14563954, 14760757, 15991283, 16419152, 16489684, 16595893, 16627981, 16778086, 17228877, 17711513, 19089909 View all (116 more)
Carcinoma Hepatocellular	Stimulate	31937236
Carcinoma Intraductal Noninfiltrating	Associate	32980776
Carcinoma Merkel Cell	Associate	17115023, 32753470
Carcinoma Mucoepidermoid	Associate	21804218, 27682876
Carcinoma Non Small Cell Lung	Associate	12649266, 15265936, 16757480, 17951244, 18390835, 18854838, 19067767, 21795997, 21951562, 23082969, 23188828, 23869238, 23900080, 24300974, 24355259 View all (38 more)
Carcinoma Non Small Cell Lung	Stimulate	19138976, 28518145
Carcinoma Ovarian Epithelial	Associate	19500386, 19619321, 21623171, 22985132, 23546975, 24237932, 24452475, 24530737, 24740199, 26617813, 27012551, 27118139, 27460076, 27708225, 30395153 View all (4 more)
Carcinoma Pancreatic Ductal	Associate	18254976, 20556833, 23301098, 25299780, 28902358, 29867042, 30426611, 30841468, 31432181, 31688605, 31991068, 33525943, 34067020, 35864095, 39372406
Carcinoma Renal Cell	Inhibit	10491412, 15004148, 9694722
Carcinoma Renal Cell	Associate	18925694, 18928570, 23816956, 24334253, 24885059, 26500094, 26617834, 26918621, 27682873, 28235946, 28550686, 29357946, 29515108, 29980758, 30911345 View all (18 more)
Carcinoma Small Cell	Associate	37189139
Carcinoma Squamous Cell	Associate	15769641, 15920558, 18310089, 19892748, 20564339, 25230785, 26212909, 33925297, 34934042, 35130902, 35756488, 36557911, 37303736, 40141137
Carcinosarcoma	Associate	28193280
Cardiomegaly	Associate	28753533, 31922230
Cardiomyopathies	Associate	39294340
Cardiomyopathy Dilated	Associate	19480714, 20534156
Cardiomyopathy Hypertrophic	Associate	22447464, 35328083
Cardiovascular Diseases	Associate	20534156, 24760806, 29407886, 29968158, 31002156, 33172487, 34346841, 35831800, 36317060, 39333655
Carotid Artery Diseases	Associate	33973530, 35937796
Carotid Stenosis	Associate	20455997
Cartilage Diseases	Associate	18205922, 23603903, 24020912, 24831018, 25653475, 29806631, 32887644, 35955467
CD59 Deficiency	Associate	15986355, 16519819, 20592286, 25397881
Celiac Disease	Associate	24163129, 31591516
Cell Transformation Neoplastic	Associate	18615482, 37685940, 38005222
Cell Transformation Neoplastic	Stimulate	31173474
Cerebellar Ataxia	Associate	36104591
Cerebral Hemorrhage	Stimulate	20420814, 33206327
Cerebral Hemorrhage	Associate	32769962
Cerebral Infarction	Associate	17077523, 32164735, 34699043
Cerebral Intraventricular Hemorrhage	Associate	34445350
Cerebrovascular Disorders	Associate	10892347, 19460784, 31744135, 36479843
Charcot Marie Tooth disease Type 1D	Associate	24818816
Chemical and Drug Induced Liver Injury	Associate	11679977, 22330637, 24448807, 26655845, 27110557, 29093318, 30404796, 32418112, 33923467
Chest Pain	Associate	35831800
Chlamydia Infections	Associate	21224062
Cholangiocarcinoma	Associate	20412118, 21325634, 22972485, 23992017, 26310932, 27290989, 27571770, 27616304, 29620225, 33038372, 34948304, 35033156, 35092379, 36476255, 36972768, 38181271 View all (1 more)
Cholangiocarcinoma	Stimulate	26802647
Cholestasis	Associate	30141207
Cholesteatoma	Associate	20414373, 36837507
Cholesteatoma Middle Ear	Associate	39174880
Chondrosarcoma	Associate	20178602, 23320110, 23874483, 24047437, 25823818
Chordoma	Associate	39393273
Chorioamnionitis	Stimulate	25616398
Chromosomal Instability	Associate	18556456
Chromosome Disorders	Associate	19252413
Chronic Disease	Associate	21474709, 26931128, 32369831
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	28343144
Chronic Kidney Disease Mineral and Bone Disorder	Associate	31102786
Chronic Pain	Associate	26668319
Chronic Periodontitis	Associate	16428799, 34770985
Chronic Urticaria	Associate	38045687
Chronobiology Disorders	Associate	18832525
Churg Strauss Syndrome	Associate	16968898
Ciliopathies	Associate	24183449
Cognitive Dysfunction	Associate	24690380
Colitis Associated Neoplasms	Associate	28408791
Colitis Collagenous	Associate	15753535
Colitis Ulcerative	Stimulate	11923606, 15753535
Colitis Ulcerative	Associate	19230040, 20806430, 21245992, 23285182, 23322997, 26062845, 27476546, 28408791, 28839432, 28944823, 30513523, 31885422, 36839242, 37638002, 37960728, 38070204 View all (1 more)
Colonic Diseases	Associate	20067776
Colonic Neoplasms	Associate	10744679, 12218071, 18032824, 20424169, 22593190, 23604035, 25303828, 25431425, 25556496, 36246978
Colorectal Neoplasms	Associate	10784420, 11833093, 12398896, 12771929, 12901803, 14520472, 14527959, 15188000, 15314290, 15484295, 15655349, 15770215, 16051228, 16052516, 16551621 View all (122 more)
Colorectal Neoplasms	Inhibit	21129206, 33413474
Colorectal Neoplasms	Stimulate	34096454, 34711117, 37116131
Common Variable Immunodeficiency	Associate	26279205, 27338827, 28778864, 29477724, 30363934, 32047491, 32961586, 32972988, 33859323, 33995346, 35784294, 36105815, 36203612, 36356849, 36571238, 37600787, 38423196, 40703516 View all (3 more)
Communicable Diseases	Associate	35028007
Compassion Fatigue	Associate	34390367
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Associate	1869518
Congenital contractural arachnodactyly	Inhibit	24143223
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	19497108, 30363934
Contracture	Associate	19214689
Conversion Disorder	Associate	31992083
Corneal Dystrophies Hereditary	Associate	35028007
Corneal Endothelial Cell Loss	Associate	25356743, 25550806, 29257294, 30577658, 31990036, 34369659, 37773847, 39856662
Corneal Neovascularization	Associate	26388611
Corneal Perforation	Associate	24945726
Coronary Aneurysm	Associate	15064395
Coronary Artery Disease	Stimulate	20014193
Coronary Artery Disease	Associate	21368773, 23690573, 23692311, 24736319, 24818816, 26075620, 27525877, 29131009, 31340238, 32164735, 33177541, 33739370, 34315328, 35801781, 36184551, 36317060, 39614436 View all (2 more)
Coronary Disease	Associate	19814730, 21231951, 21726863, 23671649, 26045738, 27091178, 32957369, 35831800, 35958279
Coronary Stenosis	Associate	30910844, 37669998
Coronavirus Infections	Associate	34176764
COVID 19	Stimulate	32698440, 36177032, 37310504, 38005906
COVID 19	Associate	32783921, 33260035, 33440148, 33551236, 33691249, 33691446, 33832291, 34128959, 34188167, 34456333, 34723226, 34975885, 35301654, 35675822, 35750043 View all (17 more)
Coxa Magna	Associate	25653475
Critical Illness	Associate	25880845
Crohn Disease	Associate	10517905, 14656710, 15090455, 16519819, 18832525, 19022976, 19039087, 19230040, 22412931, 22457781, 23300802, 24918323, 24945726, 24971461, 25993687, 34629811, 37567009 View all (2 more)
Crohn Disease	Stimulate	11923606, 24971461, 29182760, 9616307
Cryopyrin Associated Periodic Syndromes	Associate	16142754
Cystic Fibrosis	Associate	10433940, 11337375, 11591888, 12388360, 12507912, 12762338, 15963954, 17210769, 19460784, 22772035, 27286825, 31118097, 31803183, 33031374
Cystic Fibrosis	Stimulate	15516493, 15661927, 15964894
Cystinosis	Associate	18325349
Cystitis	Stimulate	25369740
Cytokine Release Syndrome	Associate	12821258, 20878190, 25888873, 28450725, 31951974, 32883951, 37477130, 37794597, 39359733
Cytokine Release Syndrome	Stimulate	15828019
Cytomegalovirus Infections	Stimulate	16782382, 23418456, 32749463
Death	Associate	21704149, 23640457, 35777990, 37047592
deficiency of adenosine deaminase 2	Associate	31015188
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	26279205
Dementia	Associate	10229115
Dendritic Cell Sarcoma Follicular	Associate	26564005, 28350008, 33904632
Dentigerous Cyst	Associate	21821445
Depressive Disorder	Associate	17927689, 23512358, 37057209
Depressive Disorder	Stimulate	32247915
Dermatitis Atopic	Associate	21716324, 28713916, 35576187, 37166084
Dermatitis Atopic	Stimulate	34678092
Dermatomyositis	Associate	34997119
Diabetes Gestational	Associate	27340831, 28846666, 32434530, 33019392
Diabetes Mellitus	Associate	10829018, 12388107, 17107852, 19747262, 21846802, 28739185, 31002156, 37104866, 37406987, 39848169
Diabetes Mellitus	Stimulate	14976218, 30718683, 34494136
Diabetes Mellitus Type 1	Associate	28607106, 32221364
Diabetes Mellitus Type 2	Associate	15941782, 21931634, 23110196, 25368101, 29641741, 31803180, 32041280, 32470060, 33164551, 33272295, 33562405, 33684886, 35032412, 35046895, 36462601, 36476775, 37047308 View all (2 more)
Diabetes Mellitus Type 2	Stimulate	26709083, 27904654, 34494136, 36139069
Diabetes Mellitus Type 2	Inhibit	29509263
Diabetic Angiopathies	Associate	14504138
Diabetic Foot	Associate	34474187
Diabetic Nephropathies	Associate	18325349, 27069916, 38115276, 39511608
Diabetic Retinopathy	Associate	14737065, 29626212, 29853786, 31298304, 35196182
Diastrophic dysplasia	Associate	24818816, 36317060, 37669998
Digestive System Diseases	Associate	30528300
Disease	Associate	11771666, 28715461, 30528300
Disease Progression	Associate	19850643
Disease Resistance	Associate	30353128
DNA Virus Infections	Associate	27041570, 29565449
Down Syndrome	Associate	33633844
Drug Hypersensitivity	Associate	11433385
Drug Related Side Effects and Adverse Reactions	Associate	11877286, 15592829, 16158947, 17185461, 18025182, 18334673, 18636537, 19060926, 19739098, 19809428, 19934274, 20862547, 21533553, 23063726, 23515408 View all (10 more)
Drug Related Side Effects and Adverse Reactions	Inhibit	23237561
Drug Resistant Epilepsy	Associate	26498772
Dry Eye Syndromes	Associate	22025895, 36361504
Dyskinesia Drug Induced	Inhibit	9516441
Dyskinesias	Associate	20610663, 30763763
Dyslipidemias	Associate	38508990
Dysmenorrhea	Associate	23706331
Dystonia 3 Torsion X Linked	Associate	28017799, 32739252
Ectodermal Dysplasia	Associate	12651765, 15337789, 18523147, 20652730, 21309033, 35741818, 36292785
Ectodermal Dysplasia	Inhibit	23563313
Ectodermal Dysplasia 1 Anhidrotic	Stimulate	32176048
Ectodermal Dysplasia 1 Anhidrotic	Associate	36448232
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Associate	14523047
Ectodermal dysplasia hypohidrotic with immune deficiency	Associate	18412279, 22156202, 28629746
Edema	Associate	35260880
Embolism Fat	Associate	30845774
Embolism Paradoxical	Associate	35937796
Embryo Loss	Associate	25486864
Empyema Subdural	Associate	20652730
Encephalitis	Associate	30303592
Encephalitis Herpes Simplex	Associate	21722947, 36555725
Encephalomyelitis Acute Disseminated	Stimulate	33597947
Encephalomyelitis Autoimmune Experimental	Associate	35449863
Endocrine System Diseases	Associate	24564526, 28794470
Endometrial Hyperplasia	Associate	12237915
Endometrial Neoplasms	Associate	15016316, 16735506, 21739232, 22640183, 24042437, 24296733, 32319602, 34039951, 35404759, 36601599, 37233761, 37917013
Endometriosis	Associate	24966899, 25500022, 30259980, 31173276, 31551156, 32311852, 32626910, 34266426, 36339397, 37389684, 37582772
Endometritis	Associate	35100093
Enteritis	Associate	34151668
Enterocolitis Necrotizing	Associate	36629694, 39342173
Eosinophilia	Associate	10666192, 12067303
Eosinophilic Esophagitis	Associate	26992000
Ependymoma	Associate	28510691
Epilepsy Partial with Variable Foci	Associate	34266426
Epilepsy Post Traumatic	Associate	27530814
Epilepsy Temporal Lobe	Associate	22698689
Epiretinal Membrane	Associate	14737065
Epstein Barr Virus Infections	Associate	15047827, 22661084, 22711707, 27338827, 30487243, 30974373, 36075565
Epstein Barr Virus Infections	Stimulate	16611410, 24581222, 24696473, 31816062, 35021606
Esophageal Neoplasms	Associate	19558549, 22292433, 22919244, 24854841, 26662448, 26681028, 27072265, 27893424, 28132116, 28832500, 30450849, 30681987, 31110076, 31324733, 32398095, 35879265, 36633144, 37286356 View all (3 more)
Esophageal Squamous Cell Carcinoma	Associate	16680372, 21939555, 24188482, 24529193, 25355139, 27689325, 27893424, 28832500, 29379981, 30207835, 30763763, 31324733, 32065218, 33374641, 33572115 View all (8 more)
Euthyroid Sick Syndromes	Associate	10930442
Fabry Disease	Associate	33673551
Familial cylindromatosis	Inhibit	16301742, 24461064, 30285829
Familial cylindromatosis	Associate	24760882, 32901872
Familial Mediterranean Fever	Associate	14514692
Familial medullary thyroid carcinoma	Associate	23201134
Familial Primary Pulmonary Hypertension	Associate	24124488
Fanconi Anemia	Associate	19934314, 21912593, 9475178
Fasciitis	Associate	36892687
Fasciitis Necrotizing	Associate	36892687
Fatigue	Associate	20854893, 29579369
Fatigue Syndrome Chronic	Associate	30791746, 37373402
Fatty Liver	Associate	30250040, 35013040
Fatty Liver Alcoholic	Associate	24997224, 27002799
Fetal Growth Retardation	Stimulate	15502418
Fetal Growth Retardation	Associate	34697371
Fetal Membranes Premature Rupture	Associate	29796818
Fever	Associate	8605359
Fibrocartilaginous embolism	Associate	26752489, 27220474, 28161709, 29617687, 30468453, 31322007, 31518335, 31927560, 32705171, 32841225, 33111436, 33734570, 33869626, 34663388, 37525423, 37928874 View all (1 more)
Fibroma	Associate	1979714
Fibrosarcoma	Associate	15883164, 21898400
Fibrosis	Associate	12675842, 22330637, 26931128, 28339089, 30250040, 30836660, 32775415, 32927894, 33795727, 33831572, 34888734, 36520540, 36615756, 38027143, 9990294
Focal cortical dysplasia of Taylor	Associate	36301030
Focal Epithelial Hyperplasia	Associate	20414373
Fuchs' Endothelial Dystrophy	Associate	27403035
Gallbladder Neoplasms	Associate	24551272, 32633352, 36401185
Gastritis	Associate	27084101, 30382864, 35089437
Gastroenteritis	Associate	25626907
Gastroesophageal Reflux	Associate	35988839
Gastrointestinal Diseases	Associate	21474709, 32278790, 35008842
GATA2 Deficiency	Associate	16173963, 30340635
Gaucher Disease	Stimulate	32485674
Genetic Diseases Inborn	Associate	16950813, 17692804, 1869518, 22874878, 31117293, 32972988
Genomic Instability	Associate	31299491
Gerodermia osteodysplastica	Associate	32735324
Gestational Trophoblastic Disease	Associate	28259870
Gingival Diseases	Associate	31743516, 33934404
Glaucoma	Associate	21408173, 24452954, 26396484
Glioblastoma	Associate	11381677, 14701753, 15328202, 15504253, 18242184, 19725919, 20669099, 21073634, 22145100, 22318540, 23538445, 23908590, 24413684, 24901050, 25215581 View all (29 more)
Glioma	Associate	15184909, 15504253, 15611130, 17011514, 17012236, 17404102, 18320068, 18708058, 19037095, 19423540, 20035051, 20157762, 21220502, 21279667, 22093097 View all (46 more)
Glioma	Stimulate	18327814, 18779315
Gliosarcoma	Associate	28193280
Glomerulonephritis IGA	Associate	19037255, 31974601
Glomerulonephritis Membranous	Associate	35477557, 37960769
Glucagonoma	Associate	34232979
Glucocorticoid Receptor Deficiency	Inhibit	16380507
Glucosephosphate Dehydrogenase Deficiency	Associate	27097228, 31350345
Glucosephosphate Dehydrogenase Deficiency	Stimulate	31476350
Glut1 Deficiency Syndrome	Associate	31568704
Gonorrhea	Stimulate	21844239
Graft vs Host Disease	Associate	19019947, 32818226, 36470572
Granuloma	Associate	30405617, 32350353
Granulomatous Disease Chronic	Associate	18523147
Granulosa Cell Tumor	Associate	23322721, 24416423
Granulosa cell tumor of the ovary	Associate	23674259, 26261481
Graves Disease	Associate	16519819, 17348243, 23717583
Graves Ophthalmopathy	Associate	23092922, 33488522, 33658982, 33886620
Growth Disorders	Associate	37600787
Guillain Barre Syndrome	Associate	10542212, 35911688
HAIR AN syndrome	Stimulate	12496485, 23452621, 23967300
Hashimoto Disease	Associate	35720300
Haspeslagh Fryns Muelenaere syndrome	Associate	29164949
Head and Neck Neoplasms	Associate	18334025, 22058147, 23455325, 25331947, 26895469, 27686740, 29921694, 31624067, 35634245, 35725478, 35838554
Headache	Associate	36332842
Hearing Loss	Associate	25397881, 32553077
Hearing Loss Sensorineural	Associate	25397881
Hearing Loss Sensorineural	Stimulate	32553077
Heart defects limb shortening	Stimulate	30690224
Heart Diseases	Associate	12821258, 14960579, 27226520, 35147204, 35212385, 36958170
Heart Failure	Stimulate	12932609, 16825515
Heart Failure	Associate	19480714, 20534156, 35727093
Heart Valve Diseases	Stimulate	19169931
Heart Valve Diseases	Associate	36958298
Helicobacter Infections	Stimulate	15929167, 21523770, 38064387
Helicobacter Infections	Associate	30778796, 35913642, 37894827
Hemangioma capillary infantile	Associate	20872175, 32945470
Hematologic Neoplasms	Associate	23237561
Hematoma Subdural Chronic	Associate	32479555
Hemolytic Uremic Syndrome	Stimulate	12675842
Hemorrhage	Associate	19757243
Hepatitis Alcoholic	Associate	24997224
Hepatitis B	Stimulate	18315953
Hepatitis B	Associate	19442295, 25223483, 26871511
Hepatitis B Chronic	Associate	24168509
Hepatitis C	Stimulate	11679977
Hepatitis C	Associate	12909638, 24116050, 26382585
Hepatitis C Chronic	Stimulate	11679977
Hepatolenticular Degeneration	Associate	30140708
Hereditary Autoinflammatory Diseases	Associate	26802121, 30761159, 32278790, 36332842, 37084016
Hereditary Breast and Ovarian Cancer Syndrome	Associate	14662759, 16002723, 20067776, 35937947, 36273585
Hereditary leiomyomatosis and renal cell cancer	Associate	10556199, 10637284, 11023520, 11313274, 11830490, 12000717, 12208876, 12393683, 15078899, 16960154, 17185461, 19380639, 22469134, 25139349, 26160878, 27538486, 30696620, 33307035, 8639794 View all (4 more)
Hernias Diaphragmatic Congenital	Associate	37605849
Hip Injuries	Inhibit	21760914
Hirschsprung Disease	Associate	39199380
Histiocytoma Malignant Fibrous	Associate	17233833
Histiocytosis	Associate	33904632
HIV Infections	Associate	17686171, 21556958, 21666058, 22384168, 24204950, 25198707, 25520503, 27194770, 27226520, 34335583, 7853483, 8394446
HIV Infections	Stimulate	31595161
HIV Seropositivity	Stimulate	34107171
Hodgkin Disease	Associate	10556199, 10637284, 10666192, 11313274, 12145210, 12208876, 12393683, 12456498, 12511414, 16123212, 17185461, 18296629, 19223558, 19380639, 19648161 View all (14 more)
Homocystinuria	Associate	31242583
HTLV I Infections	Associate	21895511
Huntington Disease	Associate	24459107, 26823290, 28017799
Hydronephrosis	Associate	22102915
Hyperglycemia	Stimulate	23311470, 25610879, 33038372
Hyperglycemia	Associate	31862399
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	29853786, 36463298
Hyperlipidemias	Stimulate	15585759
Hyperlysinemias	Stimulate	34068442
Hyperostosis corticalis deformans juvenilis	Associate	11771666
Hyperoxia	Associate	10666108
Hyperoxia	Stimulate	14617515
Hyperplasia	Associate	40141137
Hypersensitivity Delayed	Associate	35784294
Hypersensitivity Immediate	Associate	14966904
Hypertension	Associate	17644577, 18235092, 28397867, 36317060
Hypertension	Stimulate	20014193
Hypertension Portal	Associate	31934265
Hypertension Pregnancy Induced	Associate	17878927
Hypertension Pulmonary	Associate	12082102
Hyperthyroidism	Associate	32575434
Hyperuricemia	Associate	38508990
hyperzincemia and hypercalprotectinemia	Associate	36203570
Hypohidrosis	Associate	26802121
Hypothyroidism Congenital Nongoitrous 2	Associate	18710704
Hypoxia	Associate	10383461, 12050157, 12482504, 17030616, 17468103, 18234850, 20157762, 21388517, 21533553, 21887310, 23799118, 24063008, 24145445, 24593195, 27245780 View all (13 more)
Hypoxia	Stimulate	10487833, 14534291, 17114296, 17468103, 22984526, 24316875, 25557278, 25823824, 25861162, 26647763, 27058421, 28677369, 30468453, 30634531, 30704983, 32886165, 34089575, 36824025, 9892650 View all (4 more)
Hypoxia	Inhibit	27036044, 34240756
Hypoxia Brain	Associate	12736519, 17468103, 17599377, 19414389, 24042437, 25823824, 30468453, 30634531, 31671914, 35005769, 39343901
Hypoxia Brain	Stimulate	20151982, 26160878, 32886165, 9500201
Idiopathic Pulmonary Fibrosis	Associate	16507902, 30619270, 33730605, 36520540
Idiopathic Pulmonary Fibrosis	Stimulate	28629363
IgA Vasculitis	Associate	15142264, 15541037, 17075836, 31316519, 35256897, 9041934, 9502421
Ige Responsiveness Atopic	Associate	16519819
Ileitis	Associate	21327025
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	33864888
Immune System Diseases	Associate	15337789, 21399862, 22509977, 23563313, 24459107, 26823290, 35486341, 38423196, 40397075
Immunodeficiency Hypogammaglobulinemia and Reduced B Cells	Associate	32127472
Immunodeficiency syndrome variable	Associate	35784294
Immunoglobulin G4 Related Disease	Associate	17938575
Immunologic Deficiency Syndromes	Associate	11387339, 15337789, 21309033, 25615602, 26624524, 26802121, 27338827, 27416764, 30761159, 31803180, 35003082, 36317630, 36892687, 37600787
Impotence Vasculogenic	Associate	36555812
Incontinentia Pigmenti	Associate	32257968
Infections	Stimulate	10092659, 16379000, 17984206, 18057235, 18678660, 20674951, 24581222, 26223639, 28574503, 29244796, 32749463
Infections	Associate	15270850, 15518816, 15845545, 15917220, 1740663, 18221537, 19144703, 20038977, 21708986, 21742773, 2183031, 21957307, 22590978, 23565224, 23964142 View all (17 more)
Inferior Wall Myocardial Infarction	Associate	24969587, 26681040
Inflammation	Associate	10070274, 10206970, 10343541, 10364242, 10556199, 10607710, 10660609, 10713178, 10733597, 10748004, 10802070, 10839991, 10892347, 10938077, 11000127 View all (1078 more)
Inflammation	Stimulate	10504441, 15090542, 15456791, 16757480, 16785236, 17005669, 17673602, 18567808, 19114679, 20103608, 20177069, 20683900, 21081304, 21765477, 21795584 View all (25 more)
Inflammation	Inhibit	21726863, 24505350, 28323898, 36986236
Inflammatory Bowel Diseases	Associate	12003644, 15179032, 16299031, 16461776, 16803639, 17610002, 19230040, 19921217, 21245992, 24971461, 25927528, 28422189, 29307990, 31581194, 32714980 View all (6 more)
Inflammatory Breast Neoplasms	Associate	17700572, 18248671, 23418456, 28460441
Influenza Human	Associate	17295834, 32580383, 36366524
Influenza Human	Stimulate	36726689
Insulin Resistance	Associate	16155293, 18633101, 19403722, 19798070, 20181789, 20739506, 25486864, 27340831, 28944847, 31396538, 34034759
Insulin Resistance	Stimulate	27903298
Intellectual Disability	Associate	20004764, 22805531, 36104591
Intervertebral Disc Degeneration	Associate	25304312, 28161709, 28427186, 29038477, 29617687, 29656141, 30468453, 30717434, 31518335, 32705171, 37928874, 38041147, 39735982, 40653514
Intervertebral disc disease	Associate	32705171
Intestinal Diseases	Associate	14966904, 14977954, 15229109, 22749770, 30635407
Intestinal Perforation	Associate	24945726
Intra Articular Fractures	Associate	15828019
Intracranial Aneurysm	Associate	23675986, 23768831, 26345838, 36047894
Intracranial Embolism	Associate	28460441
Intrahepatic Cholestasis of Pregnancy	Associate	24489901
Iron Deficiencies	Inhibit	36136589
Iron Overload	Associate	25500022, 26999096, 37801989
Irritable Bowel Syndrome	Associate	17304351, 25927528
Ischemia	Stimulate	26647763
Ischemia	Associate	38072306
Ischemic Stroke	Stimulate	30588195
Ischemic Stroke	Associate	38020537
Jeune syndrome	Associate	24183449
Job Syndrome	Associate	39229272
Joint Diseases	Associate	10070274
Kashin Beck Disease	Associate	32322000
Keloid	Stimulate	18406579
Keratitis	Associate	20038977
Keratoconus	Associate	29021606, 32886165, 33443628
Keratosis Actinic	Associate	23379751
Kidney Diseases	Associate	11576350, 11698246, 18201972, 18786229, 24607031, 24755682, 28397867, 31382928
Kidney Failure Chronic	Associate	31382928
Kidney Failure Chronic	Inhibit	38382928
Kidney Neoplasms	Inhibit	15004148
Kidney Neoplasms	Associate	19920820, 23981302, 33059651, 35857125
Kidney Neoplasms	Stimulate	33336728
Klatskin Tumor	Associate	15655831
Kotzot Richter syndrome	Stimulate	39596634
Labor Pain	Associate	23666959, 30235753
Labor Pain	Stimulate	36190386
Laryngeal Neoplasms	Associate	20164024, 28409156, 29573243
Latent Autoimmune Diabetes in Adults	Associate	33391182
Leiomyoma	Associate	24755559, 26453978, 26617709
Leishmaniasis	Associate	40281485
Leprosy	Associate	23784377, 26367014
Leukemia	Associate	10090947, 10390192, 10783388, 11588023, 12176906, 12244143, 15328418, 15964800, 16513841, 17673311, 17920756, 18055871, 18952893, 19447221, 19962318 View all (26 more)
Leukemia B Cell	Associate	11748286, 18160665, 19104039, 20054396, 25352053, 29477724
Leukemia B Cell	Stimulate	34163463
Leukemia Biphenotypic Acute	Associate	25193702, 25626693, 33127669, 37095455
Leukemia Erythroblastic Acute	Associate	26739353
Leukemia Large Granular Lymphocytic	Associate	18852469, 29699990
Leukemia Lymphocytic Chronic B Cell	Associate	12411322, 12644014, 14504101, 15728130, 17463171, 18227347, 18796623, 20071661, 20940416, 21364020, 21790895, 22308293, 23515408, 24373626, 24596000 View all (27 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	23072591
Leukemia Lymphoma Adult T Cell	Associate	10090947, 10390192, 12176906, 15153339, 15650163, 16287853, 1719236, 19064727, 22264793, 22553204, 23688327, 26269411, 30787019, 30837480, 31972002 View all (4 more)
Leukemia Lymphoma Adult T Cell	Stimulate	25448402
Leukemia Monocytic Acute	Associate	23467026
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22833150, 23180012, 26722450, 27050374, 35111390, 35387632, 36498916
Leukemia Myeloid	Associate	11069054, 20385359, 20576605, 25752509, 29651431, 33439746
Leukemia Myeloid Acute	Associate	10515888, 11588023, 16223780, 17431130, 17920756, 18083845, 18202225, 22096027, 23077289, 23416210, 23467026, 23752607, 25034783, 27098354, 27577048 View all (17 more)
Leukemia Myeloid Acute	Inhibit	11698483, 19034332
Leukemia Myelomonocytic Acute	Associate	23467026
Leukemia Myelomonocytic Juvenile	Associate	9185524
Leukemia Prolymphocytic T Cell	Associate	24219331, 27469405
Leukemia Promyelocytic Acute	Associate	16554308, 22707304, 26022158, 30237268, 9566710
Leukemia T Cell	Associate	19036014
Leukoencephalopathies	Associate	22805531
Leukoencephalopathy Progressive Multifocal	Associate	19747512, 27007123
Leydig Cell Tumor	Associate	34009721
Lichen Planus Oral	Associate	29247492, 31999637, 34670484, 37629739
Lichen Sclerosus et Atrophicus	Stimulate	35399843
Lichenoid Eruptions	Associate	28715461
Light Fixation Seizure Syndrome	Associate	15337789
Limbal Stem Cell Deficiency	Associate	29327472
Liposarcoma	Stimulate	11278855
Liposarcoma	Associate	26219418
Liposarcoma Myxoid	Associate	20863376
Liver Cirrhosis	Associate	33923467, 34651657, 36274317, 37268177
Liver Cirrhosis Biliary	Associate	23000144, 27668889, 28425483, 30528300, 35838934
Liver Diseases	Associate	12909638, 15349911, 23483900
Liver Failure	Associate	15723090, 25486864, 30250040
Liver Failure Acute	Stimulate	17660862
Liver Failure Acute	Associate	37506138
Liver Neoplasms	Associate	27487029
Low Tension Glaucoma	Associate	26396484
Lung Diseases	Associate	14764095, 19422389, 22722901, 24487386, 32457348, 32823550, 32883951, 33810600
Lung Neoplasms	Associate	10823417, 18424438, 18523266, 18636537, 19284764, 20534110, 20977779, 21430781, 21768098, 21795997, 22549160, 22693540, 22753015, 22754361, 22898898 View all (42 more)
Lung Neoplasms	Inhibit	23044494, 28350008
Lupus Erythematosus Systemic	Associate	16519819, 20506525, 21905002, 21961021, 22952582, 24871463, 29367719, 30466076, 32334614, 33108347, 35120571, 35864995, 36177494, 36586539, 37001433, 37072752, 40131776 View all (2 more)
Lupus Erythematosus Systemic	Stimulate	22897816
Lupus Nephritis	Stimulate	18285351
Lupus Nephritis	Associate	26110642, 28338190, 35074933, 37099456, 37139617
Lupus Vasculitis Central Nervous System	Associate	23055186
Lymphatic Diseases	Associate	29963038
Lymphatic Metastasis	Associate	18254976, 20009901, 21939555, 26436510, 28074045, 31737131, 31870117, 36033828
Lymphatic Metastasis	Stimulate	23640294, 36799490
Lymphedema	Associate	28837798
Lymphocytosis	Associate	25352053
Lymphohistiocytosis Hemophagocytic	Associate	37401643
Lymphoma	Associate	11262391, 11825564, 12406882, 15190178, 15198731, 15894263, 15979856, 16099873, 16497967, 16751281, 16891304, 18230756, 19118383, 19608751, 20799731 View all (36 more)
Lymphoma	Stimulate	36923307
Lymphoma AIDS Related	Associate	21406721
Lymphoma B Cell	Associate	15870177, 16099873, 16497967, 17567982, 18628489, 18820675, 19380639, 20081860, 21364020, 22155272, 22361669, 23129749, 23555990, 24030746, 26819451 View all (19 more)
Lymphoma B Cell Marginal Zone	Associate	15845895, 15894263, 16917511, 17213322, 17540779, 21881048, 22102703, 22110251, 22891273, 25381127, 26679293, 27566587, 28729720, 29765142, 34952945
Lymphoma Extranodal NK T Cell	Associate	35021606
Lymphoma Follicular	Associate	18606651, 18990758, 19471018, 24231431, 24357726, 24362818, 24832791
Lymphoma Large B Cell Diffuse	Associate	11748286, 15198731, 16917511, 18160665, 18262046, 18990758, 19104039, 19118383, 19380866, 19412164, 19841089, 20054396, 20799731, 21173233, 22442255 View all (52 more)
Lymphoma Large Cell Anaplastic	Associate	12456498, 15050749, 15093542, 16108830, 18187570, 19131627, 21986812, 23545938, 33184494
Lymphoma Large Cell Anaplastic	Stimulate	16123212
Lymphoma Mantle Cell	Associate	12816986, 22024108, 27123851, 27127301, 27224912, 27697772, 28797244, 29695239, 32961552, 34882582, 36288644, 36719376
Lymphoma Non Hodgkin	Stimulate	11825564, 17650303
Lymphoma Non Hodgkin	Associate	14978135, 16081784, 16099873, 16497967, 16751281, 18990758, 19258594, 19390683, 23603894, 24481661, 25422198, 29228370, 31594826, 33837625, 34841595, 35052468 View all (1 more)
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	19890350
Lymphoma Primary Effusion	Associate	11830587, 12406882, 15067035, 15190178, 18321555, 19469019, 21792887, 22687408, 28931678
Lymphoma Primary Effusion	Inhibit	25794275
Lymphoma T Cell	Associate	27780854, 29963038, 31601188, 36249275, 9593751
Lymphoma T Cell Cutaneous	Associate	16219794, 20393484, 21224428, 25681335, 26192916, 36265653, 37427589, 9593751
Lymphoma T Cell Cutaneous	Stimulate	27732942
Lymphoma T Cell Peripheral	Associate	16123212, 25674239, 25833963, 26719098
Lymphoproliferative Disorders	Associate	14521460, 21273489, 21871426
Machado Joseph Disease	Associate	34871736
Macrophage Activation Syndrome	Associate	29367719, 29409136, 39292770
Macular Degeneration	Associate	34101738, 34445430
Macular Degeneration	Stimulate	34911940
Malaria	Associate	22682094
Malaria Cerebral	Associate	23890318
Malformations of Cortical Development Group I	Associate	32229084
Malignant mesenchymal tumor	Associate	32436333
Malnutrition	Associate	21818634
Mammary Neoplasms Animal	Associate	37005447
Mannose Binding Protein Deficiency	Associate	36105815
Marfan Syndrome	Associate	31147528, 40240926
Mast Cell Activation Disorders	Associate	28919488
Mastocytosis Systemic	Associate	15561889
Medulloblastoma	Associate	21364648, 24997224
Melanoma	Associate	10353757, 10504441, 11171586, 11557318, 11773061, 12020348, 12485424, 12527912, 15016307, 16675961, 17001349, 17070520, 17141217, 17352234, 17395010 View all (46 more)
Melanoma	Stimulate	11775058, 11997235, 22095230
Melanoma Cutaneous Malignant	Associate	19626699, 28075446, 28389511, 37843471
Memory Disorders	Associate	24690380
Meniere Disease	Associate	25397881
Meningeal Carcinomatosis	Associate	28193280
Meningioma	Associate	20406964, 32832554
Meningism	Associate	34980188, 35003082
Meningococcal Infections	Associate	35003082
Mental Retardation Autosomal Recessive 4	Associate	20004764
Metabolic Diseases	Associate	31013288, 36557849
Metabolic Syndrome	Associate	21481180, 24358323, 38069389
Metabolic Syndrome	Stimulate	29067980
Metabolism Inborn Errors	Associate	37938781
Metaplasia	Associate	29473241
Migraine Disorders	Associate	32276265
Mitochondrial complex I deficiency	Stimulate	12437580
Mitochondrial Diseases	Associate	11073986, 21742773, 22549761, 23900080, 25772758, 28317877, 28794470, 32554850, 35364376, 35886907, 36958170
Mouth Neoplasms	Associate	18234965, 22509384, 23138939, 25951128, 26662963, 28155253, 29635862, 30372446, 31943292, 32519370, 35151562, 35396527, 37678860
Moyamoya Disease	Associate	32139119
Mucocutaneous Lymph Node Syndrome	Associate	32808647, 37773705
Multiple Myeloma	Associate	10216101, 11703322, 11872748, 12010810, 12393461, 12433678, 14965369, 15467434, 15498850, 16234364, 16497877, 16818641, 17164350, 17542984, 17692804 View all (63 more)
Multiple Myeloma	Stimulate	17311991, 25856582, 27016342
Multiple Organ Failure	Associate	11141228, 25880845
Multiple Pterygium Syndrome Autosomal Dominant	Associate	36317630
Multiple Sclerosis	Stimulate	10550297
Multiple Sclerosis	Associate	11389171, 14641910, 16519819, 18054783, 18511806, 18776589, 19398961, 22189043, 23077530, 26062845, 27278126, 30343897, 30463275, 30559390, 36725329, 38245759, 40131776 View all (2 more)
Muscle Neoplasms	Associate	20110400, 26931128
Muscular Atrophy	Associate	19857958, 20045871, 20739506, 38017491
Muscular Atrophy	Stimulate	35800215
Muscular Atrophy Spinal	Associate	39325116
Muscular Diseases	Associate	9482906
Muscular Dystrophy Duchenne	Associate	21842588, 27745838, 28074489, 33678513
Musculoskeletal Pain	Associate	22405131
Myasthenia Gravis	Associate	23055271, 30048972, 37975358
Mycobacterium Infections	Associate	30761159
Mycosis Fungoides	Associate	24226419
Myelodysplastic Syndromes	Associate	16223780, 18838202, 20472834, 23604035, 24690917, 25913414, 30315231, 36216757, 40397075
Myeloproliferative Disorders	Associate	28008177
Myocardial Infarction	Associate	29407886, 33177541, 33879068
Myocardial Ischemia	Associate	33191336
Myocardial Stunning	Associate	19169931
Myocarditis	Associate	34414385
Myofibrillar Myopathy	Associate	27075172
Myoma	Associate	23690221
Myopathies Structural Congenital	Associate	32910558
Myopathy with Giant Abnormal Mitochondria	Associate	28317877
Myositis	Associate	22210660
Myositis Inclusion Body	Associate	17261282
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	32751648
Myotonic Dystrophy	Stimulate	30845774, 33172487, 36139069
Nasal Polyps	Stimulate	10759457, 28714566
Nasal Polyps	Associate	22030969, 23709377, 39253973
Nasopharyngeal Carcinoma	Associate	17881446, 18367518, 19860880, 20338061, 20637487, 22384168, 23563985, 24845412, 25861643, 26161396, 27147748, 27647909, 28053105, 28098136, 28256603 View all (18 more)
Nasopharyngeal Carcinoma	Inhibit	35131382
Nasopharyngeal Neoplasms	Associate	28098136, 32400857, 35394843
Necrosis	Stimulate	21474651, 27076368
Necrosis	Associate	29046333, 36899812
NEMO mutation with immunodeficiency	Associate	26802121
Neoplasm Invasiveness	Associate	15769641, 23145117
Neoplasm Metastasis	Associate	10373501, 10788437, 14679213, 14711835, 15682491, 15710601, 15811958, 16109772, 1683872, 18505918, 18942118, 19288574, 19533666, 19538528, 19892748 View all (85 more)
Neoplasm Metastasis	Stimulate	1913456, 32668608, 36823376
Neoplasms	Associate	10049353, 10373501, 10638962, 10744043, 10849002, 11069054, 11120850, 11278366, 11310828, 11313274, 11676830, 11872748, 12027803, 12208876, 12216086 View all (582 more)
Neoplasms	Inhibit	10491412, 15991280, 18313383, 19037095, 19223857, 19252413, 20414373, 22979979, 24345884, 24410930, 25255445, 26081366, 26564005, 28350008, 29573243, 34873064, 37175530, 8995542 View all (3 more)
Neoplasms	Stimulate	11171586, 12860397, 14630924, 14662759, 15259072, 18347013, 19910110, 20930110, 21279667, 22509977, 22593190, 26802647, 27042000, 31243131, 33684939 View all (4 more)
Neoplasms Adipose Tissue	Stimulate	22025778
Neoplasms Adipose Tissue	Associate	36184551
Neoplasms Cystic Mucinous and Serous	Associate	21317880, 25007180
Neoplasms Glandular and Epithelial	Associate	16164629, 16489115
Neoplasms Neuroepithelial	Associate	29348602
Neoplasms Squamous Cell	Associate	27132513, 34738714
Nephritis Interstitial	Associate	18285351
Nephrogenic Fibrosing Dermopathy	Associate	20959327
Nephrosis Lipoid	Associate	11576350
Nephrotic Syndrome	Associate	15882260, 22551315, 40055727
Nerve Degeneration	Associate	21842588, 27512062, 28074489, 33185768, 33678513, 36317630, 37991381
Nervous System Diseases	Associate	12699414
Netherton Syndrome	Associate	10666192
Neuralgia	Associate	30717434, 30887716
Neuroacanthocytosis	Associate	30453283
Neuroblastoma	Associate	11679590, 12089148, 12198114, 16001969, 17215959, 17250678, 17542780, 18280257, 18305409, 1902412, 19436149, 21236599, 23967300, 25503960, 25527973 View all (4 more)
Neurodegenerative Diseases	Associate	10206970, 15660126, 17712623, 17895971, 20488324, 25695505, 28017799, 33036367, 34415075, 36055286
Neurofibromatosis 2	Inhibit	30761159
Neurofibromatosis 2	Associate	30761159
Neuroinflammatory Diseases	Associate	21712995, 29671417, 30622674, 32210464, 33821330, 34104310, 34852990, 34980188, 35027554, 35684465, 35977506, 36005538, 36523959, 36903325, 37151606, 37314658, 37334594, 37922650 View all (3 more)
Neurologic Manifestations	Associate	15063753, 24690380
Neurotoxicity Syndromes	Associate	34333522
Neutrophil Actin Dysfunction	Associate	34335583
Non alcoholic Fatty Liver Disease	Stimulate	19165171
Non alcoholic Fatty Liver Disease	Associate	33144913
Non Muscle Invasive Bladder Neoplasms	Associate	36430344
Norrie disease	Associate	32041280
Obesity	Associate	18356846, 18633101, 19165171, 19237660, 19798070, 20739506, 20846165, 21481180, 21622727, 23671649, 24484739, 24929539, 26586913, 31013288, 32188105, 33878036, 38203423, 39457458 View all (3 more)
Obesity	Stimulate	30845774
Obesity Abdominal	Associate	23671649
Obesity Morbid	Associate	27507606
Odontogenic Cysts	Associate	21821445
Oncogene Addiction	Stimulate	24499937
Opitz Kaveggia syndrome	Associate	7579698
Optic Nerve Glioma	Stimulate	11381677
Oropharyngeal Neoplasms	Associate	28418119
Ossification Heterotopic	Associate	30429363
Ossification of Posterior Longitudinal Ligament	Associate	35391932
Osteitis Deformans	Associate	14584883, 19257822, 24642144, 29782529
Osteoarthritis	Inhibit	16427328
Osteoarthritis	Associate	20113495, 21172926, 22549135, 22549761, 23603903, 25888873, 27307355, 27433031, 27958655, 28000846, 28314786, 29095952, 29806631, 30133133, 30551507 View all (21 more)
Osteoarthritis Knee	Stimulate	23608377
Osteoarthritis Knee	Associate	27958655, 30135182, 32409720
Osteogenesis imperfecta type 1A	Associate	23675986
Osteoglophonic dwarfism	Associate	32096202
Osteomyelitis	Associate	37459905
Osteopetrosis	Associate	26178921
Osteoporosis	Associate	22897816, 32620113, 35937796, 36311708, 37344864
Osteosarcoma	Associate	16630341, 22506069, 25490312, 25874486, 26617729, 27144433, 27669226, 27706678, 28387915, 29461588, 29734183, 30536304, 30936265, 31173281, 31364725 View all (4 more)
Ovarian Cysts	Associate	39377902
Ovarian Diseases	Associate	23044494
Ovarian Neoplasms	Associate	11773061, 14670967, 17724468, 18335034, 18408758, 18667446, 19500386, 19517469, 20424119, 20564628, 21623171, 22110186, 22228447, 23591404, 23714001 View all (40 more)
Ovarian Neoplasms	Inhibit	25659662
Ovarian Neoplasms	Stimulate	30622051
Overweight	Associate	21622727
Pain	Associate	29749446, 30717434, 37175520
Pancreatic Neoplasms	Associate	12865934, 14679213, 15476283, 17410536, 17622249, 18680225, 18829575, 19050262, 19405981, 19414389, 19502791, 19670328, 19940030, 20124483, 20484017 View all (41 more)
Pancreatitis	Associate	26458814, 34882521
Pancreatitis	Stimulate	34599510
Pancreatitis Chronic	Associate	15166955, 16127431, 17962362
Papilloma	Associate	20131316
Papillomavirus Infections	Associate	24586810
Paralysis	Associate	24574500
Paramyxoviridae Infections	Associate	19922606
Paraparesis Tropical Spastic	Associate	21212284, 32912211, 9482906
Parkinson Disease	Stimulate	12437580
Parkinson Disease	Associate	19880420, 22156489, 23669642, 24593806, 28017799, 33161109, 34721431
Pediatric Obesity	Associate	32247915
Peeling Skin Syndrome	Associate	26970370
Pelvic Organ Prolapse	Associate	28849117
Pemphigoid Bullous	Associate	28351660
Peri Implantitis	Associate	21224062, 34858391, 36267464
Periodic fever familial autosomal dominant	Stimulate	16142754, 35707534
Periodic fever familial autosomal dominant	Associate	18163488, 31009059
Periodontal Diseases	Associate	25861162
Periodontitis	Associate	19405838, 25037760, 31144533, 31852255, 33851594, 34174589, 37351818
Periodontitis	Stimulate	25861162
Periprosthetic Fractures	Associate	15913942
Peritonitis	Associate	1683872, 33655604
Persistent Infection	Stimulate	7853483
Personality Disorders	Associate	23388133, 28724890, 29749446, 33038372, 34734468, 34907738, 35945910
Phyllodes Tumor	Associate	23150175
Pigmentation Disorders	Associate	34639063
Placenta Previa	Stimulate	36374543
Plaque Amyloid	Stimulate	22654105
Plaque Atherosclerotic	Associate	10339475, 23671649, 25757594, 28637660, 37189131
Plaque Atherosclerotic	Stimulate	15064395
Plasmablastic Lymphoma	Associate	34714908
Pneumococcal Infections	Associate	16950813, 21171993
Pneumonia	Associate	16049063, 22469312, 24759736, 26619903, 37614219
Pneumonia	Stimulate	35933468
Polycystic Kidney Autosomal Dominant	Associate	26666710, 30228110
Polycystic Kidney Diseases	Associate	26666710
Polycystic Ovary Syndrome	Stimulate	22045316
Polycystic Ovary Syndrome	Associate	28617068, 32140727
Polycythemia Vera	Associate	35008095
Polyendocrinopathies Autoimmune	Associate	37938781
Polyomavirus Infections	Associate	28202068
Polyostotic osteolytic dysplasia hereditary expansile	Associate	11771666
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	19398961
Popliteal Artery Aneurysm	Stimulate	20488324
Pre Eclampsia	Associate	15502418, 31467616
Pre Eclampsia	Stimulate	22380486
Precancerous Conditions	Associate	12913277, 14716817, 20009901, 21576240, 26068031, 29188362, 37240039, 37861557
Precancerous Conditions	Stimulate	18974130
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	15142883, 23752607, 24393203, 25384343, 37895229
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17927689, 18322253, 19036014, 19388934, 20701602, 21730014, 22362744, 24329526, 25384343, 25526629, 26292723, 30116272
Preeclamptic toxemia	Stimulate	15502418, 21490790, 31138166
Pregnancy Ectopic	Associate	21224062
Premature Birth	Stimulate	29682558
Primary Immunodeficiency Diseases	Associate	27338827, 27416764, 29477724, 32278790, 34557185, 36402602, 36586539
Primary Immunodeficiency Diseases	Stimulate	29963038
Primary Myelofibrosis	Associate	28008177
Prostatic Hyperplasia	Associate	21081304, 21499820, 26709083, 32416730, 34073143
Prostatic Intraepithelial Neoplasia	Associate	21081304
Prostatic Neoplasms	Associate	15240830, 16052512, 16205698, 16278667, 16543232, 16640785, 16756716, 17876045, 18444250, 18519641, 18615482, 18723484, 18942118, 18948740, 19055752 View all (81 more)
Prostatic Neoplasms	Stimulate	24587325
Prostatic Neoplasms	Inhibit	26788504, 33784024
Prostatic Neoplasms Castration Resistant	Associate	24913494, 25220414, 27542219, 28561752, 28910332, 36982155
Prostatitis	Associate	12137562, 18615482, 20067776, 21270144, 24664372, 24700612, 25125658, 33784024, 37047218
Protein Energy Malnutrition	Associate	38017491
Proteinuria	Stimulate	11576350
Proteinuria	Associate	12969130
Psoriasis	Associate	15955104, 16519819, 19169254, 26212909, 28239238, 29194363, 30543901, 36498953
Psoriasis	Stimulate	27071417, 29182760
Pterygium	Associate	28050122, 34369985, 36768371
Pulmonary Arterial Hypertension	Associate	18708631, 22718766, 36233263
Pulmonary Arterial Hypertension	Stimulate	24124488
Pulmonary Disease Chronic Obstructive	Associate	15170030, 19296848, 19717478, 19841186, 23877858, 24368768, 24993907, 25409035, 25943190, 26809128, 33510050, 34435653, 38214374, 38335160
Pulmonary Disease Chronic Obstructive	Stimulate	22441735, 27035424, 30034228
Pulmonary Embolism	Associate	24097561, 33810533
Pulmonary Fibrosis	Associate	32319542, 33123215, 33832291, 37944440
Pulpitis	Associate	33777260, 34605740, 35411569, 39343901
Purpura Thrombocytopenic Idiopathic	Associate	29327472, 30140708
Pyoderma Gangrenosum	Associate	36892687
Pyruvate Carboxylase Deficiency Disease	Associate	22384099
Pyruvate Carboxylase Deficiency Disease	Stimulate	23360921
Pythiosis	Stimulate	30118247
Radiation Injuries	Associate	23512358, 28586028
Radiation Pneumonitis	Associate	34964782
Rectal Neoplasms	Associate	20630669, 35502302
Renal Insufficiency Chronic	Associate	18786229, 25585822, 26678048, 38017491
Reperfusion Injury	Associate	29256892, 36574951, 36856879
Reperfusion Injury	Stimulate	36989330
Reproductive Tract Infections	Associate	26617709
Respiratory Distress Syndrome	Associate	21573030, 30655311, 31261506
Respiratory Insufficiency	Associate	32278790
Respiratory Tract Infections	Associate	36571238
Retinal Diseases	Associate	28829844, 31298304
Retinal Drusen	Associate	34911940
Retinal Dysplasia	Stimulate	14966904
Retinal Dysplasia	Associate	15920558, 29473241
Retinal Dystrophies	Associate	36332842
Retinitis	Associate	38085518
Retinoblastoma	Associate	19252413, 25169718, 31483776, 32277665, 40142291
Retinoblastoma	Inhibit	2181449
Rett Syndrome	Associate	20934504
Rhabdomyosarcoma	Associate	27960157, 36980247
Rheumatic Diseases	Associate	10070274
Rhinitis Allergic	Associate	28626165
Rigid spine syndrome	Associate	24997224
Ring Chromosome 20 Syndrome	Associate	33191336, 35147204
Rotator Cuff Injuries	Associate	35725478
Salivary Gland Neoplasms	Associate	16900776
Sarcoidosis	Associate	16935475, 20039400, 21177920, 24768588, 26051272
Sarcoma Ewing	Associate	15581626, 16857678, 27317769
Sarcoma Kaposi	Associate	11507211, 21792887, 30029010, 37032379
Sarcopenia	Associate	38320732, 39519004
Schizophrenia	Inhibit	25740047
Schizophrenia	Associate	33436571, 33562405, 35027554, 35995342, 36462601
Scleroderma Diffuse	Associate	33809015
Scleroderma Systemic	Stimulate	22407130
Scleroderma Systemic	Associate	23237063, 25880423, 34248934, 7882553
Sepsis	Associate	10722586, 11141228, 17592547, 25880845, 33691249, 35003082, 35777990, 35886907, 37773725
Sertoli Cell Only Syndrome	Associate	24603590
Severe Acute Respiratory Syndrome	Associate	19610265, 26893103, 31257148
Sezary Syndrome	Associate	16219794, 22936659, 28843295
Shock	Associate	31243131
Shock Septic	Associate	10477696, 37359526
Short rib polydactyly syndrome Verma Naumoff type	Associate	24183449
Signs and Symptoms	Associate	28797847
Sjogren's Syndrome	Associate	10572100, 22157716, 23944604, 24655025, 26380323, 26724675, 27142093, 27188286, 32201227, 33184486
Skin Diseases	Associate	32775415, 36203612
Skin Manifestations	Associate	29963038
Skin Neoplasms	Associate	12659672, 34583610, 39927471
Sleep Apnea Obstructive	Associate	23288968, 24293770, 27754829, 36479843, 36824025, 37189386
Sleep Apnea Obstructive	Stimulate	33335174, 34768848
Sleep Deprivation	Stimulate	18561896
Sleep Deprivation	Associate	24411622
Sleep Initiation and Maintenance Disorders	Associate	25535857, 31094102, 31296508
Sleep Wake Disorders	Stimulate	18561896
Sleep Wake Disorders	Inhibit	30690224
Small Cell Lung Carcinoma	Associate	19903458, 22898898, 24755270, 32767507
Smoke Inhalation Injury	Stimulate	36353608
Smooth Muscle Tumor	Associate	17468136, 25407893, 27441657
Soft Tissue Injuries	Associate	14600158, 2183031, 36190386, 8536713
Soft Tissue Neoplasms	Associate	1979714
Spherocytosis Type 1	Associate	23634661
Spinal Cord Injuries	Associate	26931128
Spinocerebellar Ataxia Autosomal Recessive 2	Associate	18621123
Splenomegaly	Associate	29963038, 36571238
Spondylitis Ankylosing	Associate	33717069, 38019769
Spondylosis	Associate	31322007
Squamous Cell Carcinoma of Head and Neck	Associate	11044363, 16376337, 16818647, 16984731, 17498291, 18225538, 18254958, 18684839, 19430297, 19789307, 19850643, 20695076, 20702412, 21071608, 22158872 View all (43 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	37174723
Squamous Intraepithelial Lesions	Associate	15769641, 19892748
Status Asthmaticus	Associate	19734226, 22371396
Stomach Diseases	Associate	16158947, 20038537, 22905237, 23444260, 29317648, 33242939
Stomach Neoplasms	Associate	10722567, 11310828, 12324457, 14570916, 14695762, 14716817, 15682491, 15929167, 15991280, 1684358, 17970088, 17982235, 18384434, 18720533, 1913456 View all (94 more)
Stomach Neoplasms	Stimulate	14966904, 27042000, 34773930
Stomach Ulcer	Stimulate	26060478
Stomatitis	Associate	34311536
Stroke	Associate	21114618, 31242583, 36574951, 37794467
Supratentorial Neoplasms	Associate	31375768
Synovial Cyst	Associate	11406522, 34061447
Synovitis Pigmented Villonodular	Associate	32929367
Systemic Inflammatory Response Syndrome	Associate	20151982, 29131009, 32329660, 36356849
T cell lymphoma 1A	Associate	19668332
talaromycosis	Associate	36180657
Taste Disorders	Associate	1869518
Tertiary Lymphoid Structures	Associate	21939555, 22776619
Testicular Diseases	Associate	11786414
Testicular Germ Cell Tumor	Associate	28471449, 32167697
Thoracic Injuries	Stimulate	26303896
Thromboangiitis Obliterans	Associate	38640750
Thrombocythemia Essential	Associate	33599741
Thrombosis	Associate	16879222, 29595637, 33810533, 35297992, 38203423
Thymoma	Associate	30932350, 37975358
Thyroid Cancer Papillary	Associate	17296934, 18212749, 25692306, 25887589, 26582795, 26637328, 29117154, 30254191, 35543351, 36438899
Thyroid Carcinoma Anaplastic	Associate	28459364, 29924913, 34360846
Thyroid Neoplasms	Associate	18651802, 18768801, 20492683, 22438958, 26263379, 26823762, 28099584, 29393421, 30244247, 31578590, 33975520, 34703209
Tibial Meniscus Injuries	Associate	24315792
Tissue Adhesions	Associate	26719893
Tongue Neoplasms	Associate	36639835
Tooth Resorption	Associate	22687048, 35082271, 36901758
Toxoplasmosis	Associate	40281485
Tricuspid Valve Stenosis	Associate	36555139
Triple Negative Breast Neoplasms	Associate	23185507, 23934482, 26494004, 26767845, 26943587, 27162557, 27545642, 29075784, 29735611, 29801480, 30826569, 30921428, 31731625, 31936263, 32920591 View all (10 more)
Trophoblastic Neoplasms	Associate	33405003
Tuberculosis	Associate	18052967, 19915152, 28450725
Tuberculosis Meningeal	Associate	26681217
Tuberculosis Multidrug Resistant	Associate	15655831, 22927901, 30572915, 32203206, 32400857
Tuberculosis Pulmonary	Associate	15117956, 28450725
Tuberous Sclerosis	Associate	26374334, 36301030
Uniparental Disomy	Inhibit	19351844
Urethral Neoplasms	Associate	33002420
Urinary Bladder Diseases	Associate	12824899
Urinary Bladder Neoplasms	Associate	18263644, 18472007, 19682434, 21054790, 2181449, 22102915, 23271730, 23725146, 23977085, 24316875, 24443255, 24466111, 25050631, 25369740, 25846736 View all (31 more)
Urinary Tract Infections	Associate	38554019
Urologic Diseases	Associate	21474709
Uterine Cervical Dysplasia	Associate	25548486
Uterine Cervical Dysplasia	Stimulate	40141137
Uterine Cervical Neoplasms	Associate	15197583, 15247985, 15629778, 15769641, 18210747, 20009901, 20067776, 20231067, 21786035, 22074157, 23595222, 23640294, 23824834, 23940799, 24650367 View all (24 more)
Uterine Cervical Neoplasms	Inhibit	31099286
Uterine Cervicitis	Associate	40141137
Uterine Diseases	Associate	18710704, 24262718
Uveal melanoma	Associate	22653968, 31612319, 37710185
Uveitis	Associate	21908944, 23401649
Uveomeningoencephalitic Syndrome	Associate	35003060
Vaginosis Bacterial	Associate	17532476
Vascular Calcification	Associate	22796540, 29227975, 32722241
Vascular Calcification	Stimulate	34954251
Vascular Diseases	Stimulate	15972689
Vascular Diseases	Associate	19237660, 20418897, 21754991, 24760806, 25489974, 25550806, 26016511, 26138903, 35053320
Vascular Ring	Associate	29436483
Vascular System Injuries	Associate	10759767
Vasculitis	Associate	22236003
Venous Thromboembolism	Associate	23757261
Venous Thrombosis	Associate	36474713
Ventricular Remodeling	Associate	19480714, 20534156, 34939316
Vibrio vulnificus infection	Stimulate	16011519
Virus Diseases	Associate	11120850, 17035306, 19176615, 20038977, 20051109, 22792062, 24371075, 24760149, 26694452, 28855340, 31835635, 32883951, 34166398, 34549982, 35838554, 36946735, 37938781 View all (2 more)
Virus Diseases	Stimulate	15845545, 34194436
Vitamin D Deficiency	Stimulate	25380286, 36430854
Vitiligo	Associate	37731844
Vitiligo	Stimulate	40723924
Vitreoretinopathy Proliferative	Stimulate	14737065
Vitreoretinopathy Proliferative	Associate	31608440
von Hippel Lindau Disease	Associate	28235946
Vulvar Neoplasms	Associate	33291445
Waldenstrom Macroglobulinemia	Associate	18334673, 19351844, 22931316, 23532735, 23836557
Weight Loss	Associate	18356846, 26609056
Werner Syndrome	Associate	26037922
WHIM syndrome	Associate	33485325
Wounds and Injuries	Associate	26617700, 30372878, 31467874, 32684834, 32948212, 39617505
X Linked Combined Immunodeficiency Diseases	Associate	28778864, 30761159
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Associate	12089148
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	18615482

NFKB1 (nuclear factor kappa B subunit 1)