Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4783
Gene name	Nuclear factor, interleukin 3 regulated
Gene symbol	NFIL3
Synonyms (NCBI Gene)	E4BP4IL3BP1NF-IL3ANFIL3A
Chromosome	9
Chromosome location	9q22.31
Summary	The protein encoded by this gene is a transcriptional regulator that binds as a homodimer to activating transcription factor (ATF) sites in many cellular and viral promoters. The encoded protein represses PER1 and PER2 expression and therefore plays a rol

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018550	hsa-miR-335-5p	Microarray	18185580
MIRT027704	hsa-miR-98-5p	Microarray	19088304
MIRT054774	hsa-miR-183-5p	Luciferase reporter assayqRT-PCR	24423866
MIRT054774	hsa-miR-183-5p	MicroarrayqRT-PCR	35816043
MIRT1183252	hsa-miR-1269	CLIP-seq
MIRT1183253	hsa-miR-1269b	CLIP-seq
MIRT1183254	hsa-miR-1288	CLIP-seq
MIRT1183255	hsa-miR-1825	CLIP-seq
MIRT1183256	hsa-miR-199a-5p	CLIP-seq
MIRT1183257	hsa-miR-199b-5p	CLIP-seq
MIRT1183258	hsa-miR-3065-5p	CLIP-seq
MIRT1183259	hsa-miR-3200-5p	CLIP-seq
MIRT1183260	hsa-miR-3614-3p	CLIP-seq
MIRT1183261	hsa-miR-3647-3p	CLIP-seq
MIRT1183262	hsa-miR-369-3p	CLIP-seq
MIRT1183263	hsa-miR-374a	CLIP-seq
MIRT1183264	hsa-miR-374b	CLIP-seq
MIRT1183265	hsa-miR-374c	CLIP-seq
MIRT1183266	hsa-miR-3913-3p	CLIP-seq
MIRT1183267	hsa-miR-409-3p	CLIP-seq
MIRT1183268	hsa-miR-4291	CLIP-seq
MIRT1183269	hsa-miR-4310	CLIP-seq
MIRT1183270	hsa-miR-4515	CLIP-seq
MIRT1183271	hsa-miR-4694-3p	CLIP-seq
MIRT1183272	hsa-miR-4698	CLIP-seq
MIRT1183273	hsa-miR-4740-5p	CLIP-seq
MIRT1183274	hsa-miR-4773	CLIP-seq
MIRT1183275	hsa-miR-489	CLIP-seq
MIRT1183276	hsa-miR-499-3p	CLIP-seq
MIRT1183277	hsa-miR-499a-3p	CLIP-seq
MIRT1183278	hsa-miR-513a-5p	CLIP-seq
MIRT1183279	hsa-miR-655	CLIP-seq
MIRT1183252	hsa-miR-1269	CLIP-seq
MIRT1183253	hsa-miR-1269b	CLIP-seq
MIRT1183254	hsa-miR-1288	CLIP-seq
MIRT1183262	hsa-miR-369-3p	CLIP-seq
MIRT1183265	hsa-miR-374c	CLIP-seq
MIRT1183266	hsa-miR-3913-3p	CLIP-seq
MIRT1183268	hsa-miR-4291	CLIP-seq
MIRT1183269	hsa-miR-4310	CLIP-seq
MIRT1183270	hsa-miR-4515	CLIP-seq
MIRT1183271	hsa-miR-4694-3p	CLIP-seq
MIRT1183272	hsa-miR-4698	CLIP-seq
MIRT1183273	hsa-miR-4740-5p	CLIP-seq
MIRT1183279	hsa-miR-655	CLIP-seq
MIRT1183252	hsa-miR-1269	CLIP-seq
MIRT1183253	hsa-miR-1269b	CLIP-seq
MIRT1183254	hsa-miR-1288	CLIP-seq
MIRT1183255	hsa-miR-1825	CLIP-seq
MIRT1183256	hsa-miR-199a-5p	CLIP-seq
MIRT1183257	hsa-miR-199b-5p	CLIP-seq
MIRT2282448	hsa-miR-25	CLIP-seq
MIRT2282449	hsa-miR-32	CLIP-seq
MIRT1183259	hsa-miR-3200-5p	CLIP-seq
MIRT1183260	hsa-miR-3614-3p	CLIP-seq
MIRT2282450	hsa-miR-363	CLIP-seq
MIRT1183261	hsa-miR-3647-3p	CLIP-seq
MIRT2282451	hsa-miR-367	CLIP-seq
MIRT1183262	hsa-miR-369-3p	CLIP-seq
MIRT1183265	hsa-miR-374c	CLIP-seq
MIRT1183266	hsa-miR-3913-3p	CLIP-seq
MIRT1183267	hsa-miR-409-3p	CLIP-seq
MIRT1183268	hsa-miR-4291	CLIP-seq
MIRT1183269	hsa-miR-4310	CLIP-seq
MIRT1183270	hsa-miR-4515	CLIP-seq
MIRT1183271	hsa-miR-4694-3p	CLIP-seq
MIRT1183272	hsa-miR-4698	CLIP-seq
MIRT1183273	hsa-miR-4740-5p	CLIP-seq
MIRT1183275	hsa-miR-489	CLIP-seq
MIRT1183276	hsa-miR-499-3p	CLIP-seq
MIRT1183277	hsa-miR-499a-3p	CLIP-seq
MIRT1183278	hsa-miR-513a-5p	CLIP-seq
MIRT1183279	hsa-miR-655	CLIP-seq
MIRT2282452	hsa-miR-92a	CLIP-seq
MIRT2282453	hsa-miR-92b	CLIP-seq
MIRT1183258	hsa-miR-3065-5p	CLIP-seq
MIRT2431586	hsa-miR-329	CLIP-seq
MIRT2431587	hsa-miR-362-3p	CLIP-seq
MIRT1183262	hsa-miR-369-3p	CLIP-seq
MIRT1183263	hsa-miR-374a	CLIP-seq
MIRT1183264	hsa-miR-374b	CLIP-seq
MIRT2431588	hsa-miR-3941	CLIP-seq
MIRT1183267	hsa-miR-409-3p	CLIP-seq
MIRT2431589	hsa-miR-466	CLIP-seq
MIRT2431590	hsa-miR-4672	CLIP-seq
MIRT1183274	hsa-miR-4773	CLIP-seq
MIRT2431591	hsa-miR-603	CLIP-seq
MIRT1183258	hsa-miR-3065-5p	CLIP-seq
MIRT2431586	hsa-miR-329	CLIP-seq
MIRT2431587	hsa-miR-362-3p	CLIP-seq
MIRT1183262	hsa-miR-369-3p	CLIP-seq
MIRT1183263	hsa-miR-374a	CLIP-seq
MIRT1183264	hsa-miR-374b	CLIP-seq
MIRT2431588	hsa-miR-3941	CLIP-seq
MIRT1183267	hsa-miR-409-3p	CLIP-seq
MIRT2431589	hsa-miR-466	CLIP-seq
MIRT2431590	hsa-miR-4672	CLIP-seq
MIRT1183274	hsa-miR-4773	CLIP-seq
MIRT2431591	hsa-miR-603	CLIP-seq
MIRT2580490	hsa-miR-1284	CLIP-seq
MIRT1183258	hsa-miR-3065-5p	CLIP-seq
MIRT1183259	hsa-miR-3200-5p	CLIP-seq
MIRT2431586	hsa-miR-329	CLIP-seq
MIRT2580491	hsa-miR-345	CLIP-seq
MIRT1183260	hsa-miR-3614-3p	CLIP-seq
MIRT2431587	hsa-miR-362-3p	CLIP-seq
MIRT1183262	hsa-miR-369-3p	CLIP-seq
MIRT1183263	hsa-miR-374a	CLIP-seq
MIRT1183264	hsa-miR-374b	CLIP-seq
MIRT2431588	hsa-miR-3941	CLIP-seq
MIRT1183267	hsa-miR-409-3p	CLIP-seq
MIRT2580492	hsa-miR-4514	CLIP-seq
MIRT2431589	hsa-miR-466	CLIP-seq
MIRT2431590	hsa-miR-4672	CLIP-seq
MIRT2580493	hsa-miR-4692	CLIP-seq
MIRT2580494	hsa-miR-4765	CLIP-seq
MIRT1183274	hsa-miR-4773	CLIP-seq
MIRT2580495	hsa-miR-4789-5p	CLIP-seq
MIRT2431591	hsa-miR-603	CLIP-seq
MIRT2580496	hsa-miR-759	CLIP-seq
MIRT2580490	hsa-miR-1284	CLIP-seq
MIRT1183258	hsa-miR-3065-5p	CLIP-seq
MIRT1183259	hsa-miR-3200-5p	CLIP-seq
MIRT2431586	hsa-miR-329	CLIP-seq
MIRT2580491	hsa-miR-345	CLIP-seq
MIRT1183260	hsa-miR-3614-3p	CLIP-seq
MIRT2431587	hsa-miR-362-3p	CLIP-seq
MIRT1183262	hsa-miR-369-3p	CLIP-seq
MIRT1183263	hsa-miR-374a	CLIP-seq
MIRT1183264	hsa-miR-374b	CLIP-seq
MIRT2431588	hsa-miR-3941	CLIP-seq
MIRT1183267	hsa-miR-409-3p	CLIP-seq
MIRT2580492	hsa-miR-4514	CLIP-seq
MIRT2431589	hsa-miR-466	CLIP-seq
MIRT2431590	hsa-miR-4672	CLIP-seq
MIRT2580493	hsa-miR-4692	CLIP-seq
MIRT2580494	hsa-miR-4765	CLIP-seq
MIRT1183274	hsa-miR-4773	CLIP-seq
MIRT2580495	hsa-miR-4789-5p	CLIP-seq
MIRT2431591	hsa-miR-603	CLIP-seq
MIRT2580496	hsa-miR-759	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20093779
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	20093779
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	1620116
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	1620116, 20093779
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001779	Process	Natural killer cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7565758
GO:0005515	Function	Protein binding	IPI	20102225, 21516116, 23661758, 25416956, 25609649, 28514442, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	1655749, 23661758
GO:0005634	Component	Nucleus	TAS	7565758
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	1655749, 23661758
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	7565758
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	7565758
GO:0007623	Process	Circadian rhythm	IBA
GO:0007623	Process	Circadian rhythm	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0042802	Function	Identical protein binding	IPI	20102225, 23661758
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	1620116
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758

MIM	HGNC	e!Ensembl
605327	7787	ENSG00000165030

Q16649

Protein name

Nuclear factor interleukin-3-regulated protein (E4 promoter-binding protein 4) (Interleukin-3 promoter transcriptional activator) (Interleukin-3-binding protein 1) (Transcriptional activator NF-IL3A)

Protein function

Acts as a transcriptional regulator that recognizes and binds to the sequence 5'-[GA]TTA[CT]GTAA[CT]-3', a sequence present in many cellular and viral promoters. Represses transcription from promoters with activating transcription factor (ATF) s

PDB

8K86 , 8K89 , 8K8A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07716	bZIP_2	72 → 125	Basic region leucine zipper	Coiled-coil
PF06529	Vert_IL3-reg_TF	130 → 461	Vertebrate interleukin-3 regulated transcription factor	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in bladder stomach, thyroid, spinal cord, lymph node, trachea, adrenal gland, bone marrow and muscle. {ECO:0000269|PubMed:10942106}.

Sequence

MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSAC
RRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL
SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIK
HSPQSSLSDVSEVSSVEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYT
ASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIH
SPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQKLSSPIDMTSK
RHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD
SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG

Sequence length

462

Interactions

View interactions

	KEGG
	Circadian rhythm

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
NFIL3-related disorder	Likely benign	rs142259863, rs777304490	RCV003960972 RCV003951592

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	36238290, 36969166
Arthritis Rheumatoid	Stimulate	36439145
Autoimmune Diseases	Associate	36439145
Breast Neoplasms	Associate	28036274, 29467226, 36647876, 39201344
Carcinogenesis	Associate	27586240
Carcinoma Hepatocellular	Associate	10074173
Cardiovascular Abnormalities	Associate	35205232
Choriocarcinoma	Associate	29215740
Coronary Artery Disease	Stimulate	37933872
Glioma	Associate	27586240
Heart Diseases	Associate	32664164
Heart Failure	Associate	34514752
Hypertension	Associate	32664164, 35205232
Inflammation	Associate	37933872
Leukemia	Associate	16630563, 26102033
Leukemia Lymphocytic Chronic B Cell	Associate	25280001
Malformations of Cortical Development Group I	Associate	16630563
Melanoma Cutaneous Malignant	Associate	37373286
Mucocutaneous Lymph Node Syndrome	Associate	37933872
Neoplasms	Associate	23630076
Osteosarcoma	Stimulate	31886210
Phyllodes Tumor	Associate	37240386
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	25101525
Prostatic Neoplasms	Associate	28380430
Respiratory Distress Syndrome	Associate	19635508
Severe Acute Respiratory Syndrome	Associate	19635508
Stroke	Associate	34514752
Ventricular Remodeling	Associate	32664164
Wounds and Injuries	Associate	37933872

NFIL3 (nuclear factor, interleukin 3 regulated)