Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4780
Gene name Gene Name - the full gene name approved by the HGNC.
NFE2 like bZIP transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NFE2L2
Synonyms (NCBI Gene) Gene synonyms aliases
HEBP1, IMDDHH, NRF2, Nrf-2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these gene
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1057519920 C>A,G,T Likely-pathogenic 5 prime UTR variant, missense variant, coding sequence variant
rs1057519921 T>C Likely-pathogenic 5 prime UTR variant, missense variant, coding sequence variant
rs1057519922 C>G,T Likely-pathogenic, pathogenic Synonymous variant, missense variant, coding sequence variant, intron variant
rs1057519923 T>A Likely-pathogenic Missense variant, coding sequence variant, stop gained, intron variant
rs1057519924 C>A Likely-pathogenic Missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007310 hsa-miR-144-3p Luciferase reporter assay 23236440
MIRT007310 hsa-miR-144-3p Luciferase reporter assay 23236440
MIRT007311 hsa-miR-153-3p Luciferase reporter assay 23236440
MIRT007312 hsa-miR-142-5p Luciferase reporter assay 23236440
MIRT007313 hsa-miR-27a-3p Luciferase reporter assay 23236440
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 17015834, 20452972
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000976 Function Transcription cis-regulatory region binding TAS 24252804
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600492 7782 ENSG00000116044
Protein
UniProt ID Q16236
Protein name Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (Nrf-2) (Nuclear factor, erythroid derived 2, like 2)
Protein function Transcription factor that plays a key role in the response to oxidative stress: binds to antioxidant response (ARE) elements present in the promoter region of many cytoprotective genes, such as phase 2 detoxifying enzymes, and promotes their exp
PDB 2FLU , 2LZ1 , 3ZGC , 4IFL , 5WFV , 6T7V , 7K28 , 7K29 , 7K2A , 7K2B , 7K2C , 7K2D , 7K2E , 7K2K , 7O7B , 7X5E , 7X5F , 7X5G , 8EJR , 8EJS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03131 bZIP_Maf 468 561 bZIP Maf transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle. {ECO:0000269|PubMed:7937919}.
Sequence
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLY
LEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
Sequence length 605
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Protein processing in endoplasmic reticulum
Parkinson disease
Pathways in cancer
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Immunodeficiency, Developmental Delay, And Hypohomocysteinemia immunodeficiency, developmental delay, and hypohomocysteinemia rs1057519922, rs1553487947, rs1553487942, rs1553488015 N/A
colorectal cancer Colorectal cancer rs1553488015 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 36065437
Acute Aortic Syndrome Associate 34336095
Acute Disease Associate 36193742
Acute Kidney Injury Associate 33491566, 35569444, 36594097
Acute Lung Injury Associate 35910848, 36430900, 36913799
Adenocarcinoma Associate 19643729, 21489257, 24040073, 26336083, 27824809, 31828882, 33101586, 33887608, 36035281, 39261459
Adenocarcinoma of Lung Associate 24040073, 25878335, 26385919, 33219256, 33229301, 33299528, 34205320, 34617407, 35184380, 35351670, 35633885, 36504353, 36604642, 37245083, 38241355
View all (1 more)
Adenocarcinoma Papillary Associate 21248763, 24528044
Adenoma Pleomorphic Associate 25928388
Adenomyosis Associate 28817677