NEUROG1 (neurogenin 1)

Gene

• Entrez ID: 4762
• Gene name: Neurogenin 1
• Gene symbol: NEUROG1
• Synonyms (NCBI Gene): AKA, CCDDRD, Math4C, NEUROD3, bHLHa6, ngn1
• Chromosome: 5
• Chromosome location: 5q31.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017336	hsa-miR-335-5p	Microarray	18185580
MIRT021004	hsa-miR-155-5p	Proteomics	18668040
MIRT438550	hsa-let-7i-5p	ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	23884650
MIRT438550	hsa-let-7i-5p	ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	23884650
MIRT438550	hsa-let-7i-5p	ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	23884650
MIRT438550	hsa-let-7i-5p	ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	23884650
MIRT1181322	hsa-miR-1184	CLIP-seq
MIRT1181323	hsa-miR-1205	CLIP-seq
MIRT1181324	hsa-miR-1283	CLIP-seq
MIRT1181325	hsa-miR-296-5p	CLIP-seq
MIRT1181326	hsa-miR-3158-5p	CLIP-seq
MIRT1181327	hsa-miR-3168	CLIP-seq
MIRT1181328	hsa-miR-3189-5p	CLIP-seq
MIRT1181329	hsa-miR-370	CLIP-seq
MIRT1181330	hsa-miR-4447	CLIP-seq
MIRT1181331	hsa-miR-4472	CLIP-seq
MIRT1181332	hsa-miR-4659a-3p	CLIP-seq
MIRT1181333	hsa-miR-4659b-3p	CLIP-seq
MIRT1181334	hsa-miR-4763-5p	CLIP-seq
MIRT1181335	hsa-miR-541	CLIP-seq
MIRT1181336	hsa-miR-628-5p	CLIP-seq
MIRT1181337	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	EXP	20102160
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8816493
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8816493
GO:0007356	Process	Thorax and anterior abdomen determination	IGI	23419067
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	8816493
GO:0007423	Process	Sensory organ development	IBA
GO:0010458	Process	Exit from mitosis	IEA
GO:0021559	Process	Trigeminal nerve development	IGI	23419067
GO:0021650	Process	Vestibulocochlear nerve formation	IGI	23419067
GO:0022008	Process	Neurogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030432	Process	Peristalsis	IGI	23419067
GO:0030900	Process	Forebrain development	IBA
GO:0031223	Process	Auditory behavior	IGI	23419067
GO:0031536	Process	Positive regulation of exit from mitosis	IEA
GO:0035112	Process	Genitalia morphogenesis	IGI	23419067
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042472	Process	Inner ear morphogenesis	IGI	23419067
GO:0042803	Function	Protein homodimerization activity	IDA	20102160
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048634	Process	Regulation of muscle organ development	IGI	23419067
GO:0048806	Process	Genitalia development	IGI	23419067
GO:0048839	Process	Inner ear development	IGI	23419067
GO:0050885	Process	Neuromuscular process controlling balance	IGI	23419067
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	ISS
GO:0061564	Process	Axon development	IBA
GO:0070888	Function	E-box binding	IBA
GO:0070888	Function	E-box binding	IDA	20102160
GO:0070888	Function	E-box binding	IEA
GO:0070888	Function	E-box binding	ISS
GO:0071626	Process	Mastication	IGI	23419067
GO:0090102	Process	Cochlea development	IGI	23419067
GO:0090103	Process	Cochlea morphogenesis	IGI	23419067
GO:0097094	Process	Craniofacial suture morphogenesis	IGI	23419067
GO:0098583	Process	Learned vocalization behavior	IGI	23419067
GO:1901078	Process	Negative regulation of relaxation of muscle	IGI	23419067
GO:1905747	Process	Negative regulation of saliva secretion	IGI	23419067
GO:1905748	Process	Hard palate morphogenesis	IGI	23419067
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	20102160, 28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 601726
• HGNC: 7764
• e!Ensembl: ENSG00000181965

Protein

• UniProt ID: Q92886
• Protein name: Neurogenin-1 (NGN-1) (Class A basic helix-loop-helix protein 6) (bHLHa6) (Neurogenic basic-helix-loop-helix protein) (Neurogenic differentiation factor 3) (NeuroD3)
• Protein function: Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcri
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	93 → 145	Helix-loop-helix DNA-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expression restricted to the embryonic nervous system.
• Sequence:

  MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASE
  VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
  SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
  SDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHTTPCFIPYH

• Sequence length: 237

Pathways

KEGG:

Signaling pathways regulating pluripotency of stem cells

<