Gene Gene information from NCBI Gene database.
Entrez ID 4761
Gene name Neuronal differentiation 2
Gene symbol NEUROD2
Synonyms (NCBI Gene)
DEE72EIEE72NDRFbHLHa1
Chromosome 17
Chromosome location 17q12
Summary This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs1323339153 C>G,T Pathogenic Missense variant, coding sequence variant
rs1567841596 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
195
miRTarBase ID miRNA Experiments Reference
MIRT018380 hsa-miR-335-5p Microarray 18185580
MIRT711087 hsa-miR-1247-3p HITS-CLIP 19536157
MIRT711086 hsa-miR-4532 HITS-CLIP 19536157
MIRT711085 hsa-miR-6784-5p HITS-CLIP 19536157
MIRT711084 hsa-miR-5090 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
51
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601725 7763 ENSG00000171532
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15784
Protein name Neurogenic differentiation factor 2 (NeuroD2) (Class A basic helix-loop-helix protein 1) (bHLHa1) (NeuroD-related factor) (NDRF)
Protein function Transcriptional regulator implicated in neuronal determination. Mediates calcium-dependent transcription activation by binding to E box-containing promoter. Critical factor essential for the repression of the genetic program for neuronal differe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 122 174 Helix-loop-helix DNA-binding domain Domain
PF12533 Neuro_bHLH 180 310 Neuronal helix-loop-helix transcription factor Family
Sequence
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPL
RGEEGTEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYP
YPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFS
LKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLS
YDMHLHHDRGPMYEELNAFFHN
Sequence length 382
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
19
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Developmental and epileptic encephalopathy, 72 Pathogenic; Likely pathogenic rs558808033, rs1323339153, rs1567841596 RCV003337739
RCV000766210
RCV000766211
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
NEUROD2-related disorder Likely benign; Benign rs112207563, rs370086947, rs200708991, rs746061734, rs114810359 RCV003916427
RCV003933883
RCV003934148
RCV003972263
RCV003978375
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma in Situ Associate 21731750
Breast Neoplasms Male Associate 25906114
Developmental Disabilities Associate 36494631
Neoplasms Associate 25906114
Spasm Associate 36494631
Spasms Infantile Associate 35830182
Syndrome Associate 36494631
Trisomy 18 Syndrome Inhibit 22752091