Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4761
Gene name Gene Name - the full gene name approved by the HGNC.
Neuronal differentiation 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NEUROD2
Synonyms (NCBI Gene) Gene synonyms aliases
DEE72, EIEE72, NDRF, bHLHa1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1323339153 C>G,T Pathogenic Missense variant, coding sequence variant
rs1567841596 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018380 hsa-miR-335-5p Microarray 18185580
MIRT711087 hsa-miR-1247-3p HITS-CLIP 19536157
MIRT711086 hsa-miR-4532 HITS-CLIP 19536157
MIRT711085 hsa-miR-6784-5p HITS-CLIP 19536157
MIRT711084 hsa-miR-5090 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601725 7763 ENSG00000171532
Protein
UniProt ID Q15784
Protein name Neurogenic differentiation factor 2 (NeuroD2) (Class A basic helix-loop-helix protein 1) (bHLHa1) (NeuroD-related factor) (NDRF)
Protein function Transcriptional regulator implicated in neuronal determination. Mediates calcium-dependent transcription activation by binding to E box-containing promoter. Critical factor essential for the repression of the genetic program for neuronal differe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 122 174 Helix-loop-helix DNA-binding domain Domain
PF12533 Neuro_bHLH 180 310 Neuronal helix-loop-helix transcription factor Family
Sequence
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPL
RGEEGTEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYP
YPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFS
LKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLS
YDMHLHHDRGPMYEELNAFFHN
Sequence length 382
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 72 rs1323339153, rs1567841596 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma in any disease, Asthma (childhood onset), Nonatopic asthma, Atopic asthma N/A N/A GWAS
Diabetes Type 2 diabetes, Type 2 diabetes (PheCode 250.2), Type 2 diabetes with neurological manifestations (PheCode 250.24), Type 2 diabetes or schizophrenia (pleiotropy) N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Hyperopia Hyperopia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma in Situ Associate 21731750
Breast Neoplasms Male Associate 25906114
Developmental Disabilities Associate 36494631
Neoplasms Associate 25906114
Spasm Associate 36494631
Spasms Infantile Associate 35830182
Syndrome Associate 36494631
Trisomy 18 Syndrome Inhibit 22752091