Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4760
Gene name Gene Name - the full gene name approved by the HGNC.
Neuronal differentiation 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NEUROD1
Synonyms (NCBI Gene) Gene synonyms aliases
BETA2, BHF-1, MODY6, NEUROD, T2D, bHLHa3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. I
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104893649 C>A Pathogenic Coding sequence variant, intron variant, missense variant
rs149703259 G>C,T Pathogenic Coding sequence variant, synonymous variant, intron variant
rs387906384 GGG>-,GGGG Pathogenic Intron variant, coding sequence variant, inframe deletion, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007297 hsa-miR-30a-5p Western blot 23338554
MIRT725343 hsa-miR-138-5p HITS-CLIP 19536157
MIRT725342 hsa-miR-5003-3p HITS-CLIP 19536157
MIRT725341 hsa-miR-93-3p HITS-CLIP 19536157
MIRT725340 hsa-miR-3692-5p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
NEUROG3 Unknown 16855267
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 14752053, 19619559
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601724 7762 ENSG00000162992
Protein
UniProt ID Q13562
Protein name Neurogenic differentiation factor 1 (NeuroD) (NeuroD1) (Class A basic helix-loop-helix protein 3) (bHLHa3)
Protein function Acts as a transcriptional activator: mediates transcriptional activation by binding to E box-containing promoter consensus core sequences 5'-CANNTG-3'. Associates with the p300/CBP transcription coactivator complex to stimulate transcription of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 102 154 Helix-loop-helix DNA-binding domain Domain
PF12533 Neuro_bHLH 160 284 Neuronal helix-loop-helix transcription factor Family
Sequence
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEEDSLRNGGEEE
DEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALS
EILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF
HVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFS
FKHEPSAEFEKNYAFT
MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Sequence length 356
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Maturity onset diabetes of the young   Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Diabetes Mellitus Type 2 diabetes mellitus, Maturity-onset diabetes of the young type 6 rs104893649, rs149703259 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mason type diabetes maturity onset diabetes mellitus in young N/A N/A ClinVar
Monogenic Diabetes monogenic diabetes N/A N/A ClinVar, GenCC
Neurodevelopmental Disorders complex neurodevelopmental disorder N/A N/A GenCC
retinal dystrophy Retinal dystrophy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acrocephalosyndactylia Associate 9792856
Adenocarcinoma Associate 39283755
Adenocarcinoma in Situ Associate 21731750
Adenoma Associate 18079591
Ataxia Associate 25684977
Autoimmune Diseases Associate 40474235
Axenfeld Rieger syndrome Associate 17653043
Brain Injuries Traumatic Associate 21275797
Breast Neoplasms Associate 18519782
Carcinogenesis Associate 31715070, 34937609, 37987107