Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
474354
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat containing 18
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRRC18
Synonyms (NCBI Gene) Gene synonyms aliases
UNQ933, UNQ9338, VKGE9338
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q11.23
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1118996 hsa-miR-1321 CLIP-seq
MIRT1118997 hsa-miR-3150b-3p CLIP-seq
MIRT1118998 hsa-miR-3165 CLIP-seq
MIRT1118999 hsa-miR-3179 CLIP-seq
MIRT1119000 hsa-miR-3190 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0035556 Process Intracellular signal transduction IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619002 23199 ENSG00000165383
Protein
UniProt ID Q8N456
Protein name Leucine-rich repeat-containing protein 18
Protein function May be involved in the regulation of spermatogenesis and sperm maturation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 30 85 Leucine rich repeat Repeat
PF13855 LRR_8 50 108 Leucine rich repeat Repeat
PF13855 LRR_8 73 133 Leucine rich repeat Repeat
Sequence
MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRN
LIRKIPDSISKF
QNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQL
KNIRAVNLGLNHL
DSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFP
KPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNL
ISPNSMAKDSWEDWRIRLTSS
Sequence length 261
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Coronary Artery Disease Associate 33686958
Pulmonary edema of mountaineers Associate 35885976