Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4739
Gene name Gene Name - the full gene name approved by the HGNC.	Neural precursor cell expressed, developmentally down-regulated 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NEDD9
Synonyms (NCBI Gene) Gene synonyms aliases	CAS-L, CAS2, CASL, CASS2, HEF1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p24.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protei

Show/Hide all(124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006817	hsa-miR-18a-5p	qRT-PCR, Western blot	22308110
MIRT006889	hsa-miR-145-5p	Immunofluorescence, Immunohistochemistry, qRT-PCR, Western blot	22869051
MIRT006889	hsa-miR-145-5p	Luciferase reporter assay	23355420
MIRT047916	hsa-miR-30c-5p	CLASH	23622248
MIRT006889	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	24384875
MIRT006889	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR	24384875
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT454817	hsa-miR-3609	PAR-CLIP	23592263
MIRT454815	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT454814	hsa-miR-4506	PAR-CLIP	23592263
MIRT454813	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT454812	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT454811	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT454810	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT454809	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454808	hsa-miR-520h	PAR-CLIP	23592263
MIRT454807	hsa-miR-5702	PAR-CLIP	23592263
MIRT454806	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT454805	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT454804	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT454803	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT454802	hsa-miR-5682	PAR-CLIP	23592263
MIRT454801	hsa-miR-4477a	PAR-CLIP	23592263
MIRT454800	hsa-miR-642a-5p	PAR-CLIP	23592263
MIRT454799	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT454798	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT440124	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440124	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT655917	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT655916	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT655915	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT454817	hsa-miR-3609	PAR-CLIP	23592263
MIRT454815	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT454814	hsa-miR-4506	PAR-CLIP	23592263
MIRT454813	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT454812	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT454811	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT454810	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT454809	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454808	hsa-miR-520h	PAR-CLIP	23592263
MIRT454807	hsa-miR-5702	PAR-CLIP	23592263
MIRT454806	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT454805	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT454804	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT454803	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT454802	hsa-miR-5682	PAR-CLIP	23592263
MIRT454801	hsa-miR-4477a	PAR-CLIP	23592263
MIRT454800	hsa-miR-642a-5p	PAR-CLIP	23592263
MIRT454799	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT454798	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT1179924	hsa-miR-105	CLIP-seq
MIRT1179925	hsa-miR-1321	CLIP-seq
MIRT1179926	hsa-miR-1915	CLIP-seq
MIRT1179927	hsa-miR-298	CLIP-seq
MIRT1179928	hsa-miR-302f	CLIP-seq
MIRT1179929	hsa-miR-3136-5p	CLIP-seq
MIRT1179930	hsa-miR-3163	CLIP-seq
MIRT1179931	hsa-miR-3612	CLIP-seq
MIRT1179932	hsa-miR-3662	CLIP-seq
MIRT1179933	hsa-miR-4270	CLIP-seq
MIRT1179934	hsa-miR-4323	CLIP-seq
MIRT1179935	hsa-miR-4439	CLIP-seq
MIRT1179936	hsa-miR-4441	CLIP-seq
MIRT1179937	hsa-miR-4513	CLIP-seq
MIRT1179938	hsa-miR-4699-5p	CLIP-seq
MIRT1179939	hsa-miR-4719	CLIP-seq
MIRT1179940	hsa-miR-4739	CLIP-seq
MIRT1179941	hsa-miR-4756-5p	CLIP-seq
MIRT1179942	hsa-miR-4762-3p	CLIP-seq
MIRT1179943	hsa-miR-4766-5p	CLIP-seq
MIRT1179944	hsa-miR-650	CLIP-seq
MIRT1179945	hsa-miR-943	CLIP-seq
MIRT1179946	hsa-miR-34b	CLIP-seq
MIRT1179947	hsa-miR-3921	CLIP-seq
MIRT1179948	hsa-miR-4251	CLIP-seq
MIRT1179949	hsa-miR-4329	CLIP-seq
MIRT1179950	hsa-miR-4639-3p	CLIP-seq
MIRT1179951	hsa-miR-4653-5p	CLIP-seq
MIRT1179952	hsa-miR-4714-5p	CLIP-seq
MIRT2052033	hsa-miR-18a	CLIP-seq
MIRT2052034	hsa-miR-18b	CLIP-seq
MIRT2052035	hsa-miR-203	CLIP-seq
MIRT2052036	hsa-miR-4729	CLIP-seq
MIRT2052037	hsa-miR-4735-3p	CLIP-seq
MIRT1179932	hsa-miR-3662	CLIP-seq
MIRT2281397	hsa-miR-1266	CLIP-seq
MIRT2281398	hsa-miR-1294	CLIP-seq
MIRT2281399	hsa-miR-144	CLIP-seq
MIRT2052033	hsa-miR-18a	CLIP-seq
MIRT2052034	hsa-miR-18b	CLIP-seq
MIRT2281400	hsa-miR-3150b-3p	CLIP-seq
MIRT2281401	hsa-miR-3688-3p	CLIP-seq
MIRT2281402	hsa-miR-4316	CLIP-seq
MIRT2281403	hsa-miR-4328	CLIP-seq
MIRT2281404	hsa-miR-4518	CLIP-seq
MIRT2281405	hsa-miR-4652-3p	CLIP-seq
MIRT2281406	hsa-miR-4689	CLIP-seq
MIRT2052037	hsa-miR-4735-3p	CLIP-seq
MIRT2281407	hsa-miR-4760-3p	CLIP-seq
MIRT2281408	hsa-miR-4784	CLIP-seq
MIRT2281409	hsa-miR-510	CLIP-seq
MIRT2281410	hsa-miR-520d-5p	CLIP-seq
MIRT2281411	hsa-miR-524-5p	CLIP-seq
MIRT2281412	hsa-miR-576-3p	CLIP-seq
MIRT2281412	hsa-miR-576-3p	CLIP-seq
MIRT2431535	hsa-miR-3157-5p	CLIP-seq
MIRT2431536	hsa-miR-4691-3p	CLIP-seq
MIRT2431537	hsa-miR-4705	CLIP-seq
MIRT2579581	hsa-miR-1207-3p	CLIP-seq
MIRT2579582	hsa-miR-4307	CLIP-seq
MIRT2579583	hsa-miR-4774-5p	CLIP-seq
MIRT2579584	hsa-miR-567	CLIP-seq
MIRT2579581	hsa-miR-1207-3p	CLIP-seq
MIRT2579582	hsa-miR-4307	CLIP-seq
MIRT2579583	hsa-miR-4774-5p	CLIP-seq
MIRT2579584	hsa-miR-567	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	11827972, 21516116, 25416956, 28514442
GO:0005634	Component	Nucleus	TAS	8668148
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005794	Component	Golgi apparatus	IEA
GO:0005819	Component	Spindle	TAS	9584194
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007010	Process	Cytoskeleton organization	NAS	11827972
GO:0007049	Process	Cell cycle	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	8668148
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	11827972
GO:0016477	Process	Cell migration	IBA	21873635
GO:0030027	Component	Lamellipodium	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18256281
GO:0040008	Process	Regulation of growth	IEA
GO:0051017	Process	Actin filament bundle assembly	NAS	11827972
GO:0051301	Process	Cell division	IEA
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IDA	18256281
GO:0090527	Process	Actin filament reorganization	IBA	21873635
GO:0090630	Process	Activation of GTPase activity	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	18256281
GO:1990782	Function	Protein tyrosine kinase binding	IPI	18256281

MIM	HGNC	e!Ensembl
602265	7733	ENSG00000111859

Protein

UniProt ID

Q14511

Protein name

Enhancer of filamentation 1 (hEF1) (CRK-associated substrate-related protein) (CAS-L) (CasL) (Cas scaffolding protein family member 2) (CASS2) (Neural precursor cell expressed developmentally down-regulated protein 9) (NEDD-9) (Renal carcinoma antigen NY-

Protein function

Scaffolding protein which plays a central coordinating role for tyrosine-kinase-based signaling related to cell adhesion (PubMed:24574519). As a focal adhesion protein, plays a role in embryonic fibroblast migration (By similarity). May play an

PDB

2L81 , 5X3S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	10 → 61	Variant SH3 domain	Domain
PF08824	Serine_rich	404 → 560	Serine rich protein interaction domain	Domain
PF12026	CAS_C	619 → 828	Crk-Associated Substrate C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in B-cells (at protein level) (PubMed:9020138). Expressed in the respiratory epithelium of the main bronchi to the bronchioles in the lungs (at protein level) (PubMed:9584194). High levels detected in kidney, lung, and placen

Sequence

MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIP
PSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKD
YDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPN
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRD
LVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELI
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHN
KALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQDIRNKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF

Sequence length

834

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778
Glaucoma	Glaucoma, Open-Angle	rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328 View all (29 more)	22605921
Prostate cancer	Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	29892016, 25217961

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Hypothyroidism	Hypothyroidism			GWAS

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute erythroleukemia	Stimulate	34432355
Adenocarcinoma	Associate	23086683
Adenocarcinoma of Lung	Stimulate	40362444
Arthritis	Associate	37771106
Arthritis Experimental	Associate	37771106
Atherosclerosis	Associate	23468652
Breast Neoplasms	Associate	21145356, 24676793, 25319010, 31462898, 32638964, 35844785, 36604412
Breast Neoplasms	Stimulate	21829474
Carcinogenesis	Associate	40362444
Carcinoma Basal Cell	Associate	23086683
Carcinoma Endometrioid	Associate	29364471
Carcinoma Non Small Cell Lung	Stimulate	23086683
Carcinoma Non Small Cell Lung	Associate	26011298
Carcinoma Pancreatic Ductal	Associate	23247867
Carcinoma Pancreatic Ductal	Stimulate	29924959
Carcinoma Renal Cell	Associate	24384875
Carcinoma Renal Cell	Stimulate	26351211
Carcinoma Squamous Cell	Associate	37185598
Carcinoma Squamous Cell	Stimulate	40362444
Colorectal Neoplasms	Associate	20442290, 24966970, 25824783, 36604412
Dental Caries	Associate	29931343
Femur Head Necrosis	Associate	32595251
Genetic Diseases Inborn	Associate	34432355
Glaucoma Open Angle	Associate	22605921
Hypoxia	Stimulate	20442290, 31462898
Hypoxia Brain	Associate	20442290
Inflammation	Associate	20442290
Leukemia	Associate	36604412
Leukemia Lymphocytic Chronic B Cell	Stimulate	18224667
Lung Neoplasms	Associate	40362444
Lymphatic Metastasis	Stimulate	23086683, 23247867, 24058594, 24664584, 24676793
Mammary Neoplasms Animal	Associate	21145356
Melanoma	Associate	18977323, 18984162, 26968260, 28273108
Nasopharyngeal Carcinoma	Inhibit	21283797
Neoplasm Metastasis	Associate	18256281, 18977323, 20498643, 20864688, 21829474, 23086683, 24058594, 24676793, 25824783, 28468627, 30003752, 40362444
Neoplasms	Associate	20442290, 21829474, 24676793, 24966970, 25577245, 26351211, 29191835, 32638964, 33485292, 40362444, 9584194
Neoplasms	Inhibit	21283797
Neoplasms	Stimulate	23086683
Pancreatic Neoplasms	Stimulate	23247867
Pancreatic Neoplasms	Associate	25646678, 29924959
Periodontitis	Associate	40016711
Pre Eclampsia	Associate	40016711
Precancerous Conditions	Associate	24699941
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	34432355
Prostatic Neoplasms	Associate	24413182, 27078000
Pulmonary Arterial Hypertension	Stimulate	31952977
Small Cell Lung Carcinoma	Associate	32176034
Squamous Cell Carcinoma of Head and Neck	Associate	20498643, 32595251
Stomach Neoplasms	Associate	24664584, 25577245, 33485292
Triple Negative Breast Neoplasms	Stimulate	21829474
Urinary Bladder Neoplasms	Associate	30003752
Uterine Cervical Neoplasms	Associate	24058594, 39206965

NEDD9 (neural precursor cell expressed, developmentally down-regulated 9)