Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4716
Gene name Gene Name - the full gene name approved by the HGNC.	NADH:ubiquinone oxidoreductase subunit B10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NDUFB10
Synonyms (NCBI Gene) Gene synonyms aliases	MC1DN35, PDSW
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p13.3

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021832	hsa-miR-132-3p	Microarray	17612493
MIRT049618	hsa-miR-92a-3p	CLASH	23622248
MIRT037561	hsa-miR-744-5p	CLASH	23622248
MIRT1178937	hsa-miR-132	CLIP-seq
MIRT1178938	hsa-miR-1909	CLIP-seq
MIRT1178939	hsa-miR-212	CLIP-seq
MIRT1178940	hsa-miR-214	CLIP-seq
MIRT1178941	hsa-miR-3619-5p	CLIP-seq
MIRT1178942	hsa-miR-4291	CLIP-seq
MIRT1178943	hsa-miR-4688	CLIP-seq
MIRT1178944	hsa-miR-4709-5p	CLIP-seq
MIRT1178945	hsa-miR-4797-5p	CLIP-seq
MIRT1178946	hsa-miR-485-3p	CLIP-seq
MIRT1178947	hsa-miR-545	CLIP-seq
MIRT1178948	hsa-miR-761	CLIP-seq
MIRT1178937	hsa-miR-132	CLIP-seq
MIRT1178938	hsa-miR-1909	CLIP-seq
MIRT1178939	hsa-miR-212	CLIP-seq
MIRT1178940	hsa-miR-214	CLIP-seq
MIRT1178941	hsa-miR-3619-5p	CLIP-seq
MIRT1178942	hsa-miR-4291	CLIP-seq
MIRT1178943	hsa-miR-4688	CLIP-seq
MIRT1178944	hsa-miR-4709-5p	CLIP-seq
MIRT1178945	hsa-miR-4797-5p	CLIP-seq
MIRT1178946	hsa-miR-485-3p	CLIP-seq
MIRT1178947	hsa-miR-545	CLIP-seq
MIRT1178948	hsa-miR-761	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14557246, 17500595, 25416956, 28040730, 32296183, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IMP	28040730
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603843	7696	ENSG00000140990

Protein

UniProt ID

O96000

Protein name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (Complex I-PDSW) (CI-PDSW) (NADH-ubiquinone oxidoreductase PDSW subunit)

Protein function

Accessory subunit that is involved in the functional assembly of the mitochondrial respiratory chain complex I. Complex I has an NADH dehydrogenase activity with ubiquinone as an immediate electron acceptor and mediates the transfer of electrons

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10249	NDUFB10	36 → 162	NADH-ubiquinone oxidoreductase subunit 10	Family

Sequence

MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHR
QYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCI
KEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Sequence length

172

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Mitochondrial Complex Deficiency	mitochondrial complex i deficiency	rs1475753965	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Mitochondrial Diseases	mitochondrial disease	N/A	N/A	GenCC

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Cardiomyopathies	Associate	28040730
Cardiomyopathy Hypertrophic	Associate	11583900
Mitochondrial complex I deficiency	Associate	28040730, 33169436
Mitochondrial Diseases	Associate	33169436

NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)