Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4716
Gene name Gene Name - the full gene name approved by the HGNC.	NADH:ubiquinone oxidoreductase subunit B10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NDUFB10
Synonyms (NCBI Gene) Gene synonyms aliases	MC1DN35, PDSW
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MC1DN35
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p13.3

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021832	hsa-miR-132-3p	Microarray	17612493
MIRT049618	hsa-miR-92a-3p	CLASH	23622248
MIRT037561	hsa-miR-744-5p	CLASH	23622248
MIRT1178937	hsa-miR-132	CLIP-seq
MIRT1178938	hsa-miR-1909	CLIP-seq
MIRT1178939	hsa-miR-212	CLIP-seq
MIRT1178940	hsa-miR-214	CLIP-seq
MIRT1178941	hsa-miR-3619-5p	CLIP-seq
MIRT1178942	hsa-miR-4291	CLIP-seq
MIRT1178943	hsa-miR-4688	CLIP-seq
MIRT1178944	hsa-miR-4709-5p	CLIP-seq
MIRT1178945	hsa-miR-4797-5p	CLIP-seq
MIRT1178946	hsa-miR-485-3p	CLIP-seq
MIRT1178947	hsa-miR-545	CLIP-seq
MIRT1178948	hsa-miR-761	CLIP-seq
MIRT1178937	hsa-miR-132	CLIP-seq
MIRT1178938	hsa-miR-1909	CLIP-seq
MIRT1178939	hsa-miR-212	CLIP-seq
MIRT1178940	hsa-miR-214	CLIP-seq
MIRT1178941	hsa-miR-3619-5p	CLIP-seq
MIRT1178942	hsa-miR-4291	CLIP-seq
MIRT1178943	hsa-miR-4688	CLIP-seq
MIRT1178944	hsa-miR-4709-5p	CLIP-seq
MIRT1178945	hsa-miR-4797-5p	CLIP-seq
MIRT1178946	hsa-miR-485-3p	CLIP-seq
MIRT1178947	hsa-miR-545	CLIP-seq
MIRT1178948	hsa-miR-761	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14557246, 17500595, 25416956, 32296183, 32814053
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005747	Component	Mitochondrial respiratory chain complex I	IBA	21873635
GO:0005747	Component	Mitochondrial respiratory chain complex I	IDA	12611891, 27626371
GO:0005747	Component	Mitochondrial respiratory chain complex I	NAS	9878551
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	TAS
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	27626371
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	TAS

MIM	HGNC	e!Ensembl
603843	7696	ENSG00000140990

Protein

UniProt ID

O96000

Protein name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (Complex I-PDSW) (CI-PDSW) (NADH-ubiquinone oxidoreductase PDSW subunit)

Protein function

Accessory subunit that is involved in the functional assembly of the mitochondrial respiratory chain complex I. Complex I has an NADH dehydrogenase activity with ubiquinone as an immediate electron acceptor and mediates the transfer of electrons

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10249	NDUFB10	36 → 162	NADH-ubiquinone oxidoreductase subunit 10	Family

Sequence

MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHR
QYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCI
KEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Sequence length

172

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Show/Hide Causal Diseases (11)

Disease term	Disease name	dbSNP ID	References
Causal
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)
Epileptic encephalopathy	Encephalopathies	rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625 View all (860 more)
Hearing loss	Sensorineural Hearing Loss (disorder)	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Hypertrophic cardiomyopathy	Hypertrophic Cardiomyopathy	rs63750743, rs104894655, rs121908987, rs587776643, rs28938173, rs121908989, rs121908991, rs267606977, rs267606978, rs193922384, rs121909374, rs886041030, rs886041031, rs121909375, rs121909377 View all (752 more)
Leukodystrophy	Leukodystrophy	rs74315475, rs72466451, rs267608671, rs181087667, rs267608682, rs267608674, rs587778271, rs148932047, rs886037931, rs368905417, rs768180196, rs1558211070, rs1558209947, rs1558210191, rs1280845604 View all (6 more)
Leukoencephalopathy	Leukoencephalopathy	rs34757931
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Mitochondrial complex deficiency	MITOCHONDRIAL COMPLEX I DEFICIENCY	rs267606829, rs267606830, rs587776513, rs121918134, rs121918135, rs121918136, rs137853192, rs137853193, rs183973249, rs137853184, rs118203929, rs267606689, rs11544803, rs63751061, rs137852863 View all (210 more)	28040730
Mitochondrial myopathy	Mitochondrial Myopathies	rs121434454
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Ptosis	Blepharoptosis, Ptosis	ClinVar
Mitochondrial Complex Deficiency	mitochondrial complex 1 deficiency, nuclear type 35, mitochondrial complex I deficiency	GenCC
Mitochondrial Diseases	mitochondrial disease	GenCC

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Cardiomyopathies	Associate	28040730
Cardiomyopathy Hypertrophic	Associate	11583900
Mitochondrial complex I deficiency	Associate	28040730, 33169436
Mitochondrial Diseases	Associate	33169436

NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)