Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4712
Gene name Gene Name - the full gene name approved by the HGNC.	NADH:ubiquinone oxidoreductase subunit B6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NDUFB6
Synonyms (NCBI Gene) Gene synonyms aliases	B17, CI
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p21.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase act

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021295	hsa-miR-125a-5p	Sequencing	20371350
MIRT025612	hsa-miR-10a-5p	Sequencing	20371350
MIRT044986	hsa-miR-186-5p	CLASH	23622248
MIRT044986	hsa-miR-186-5p	CLASH	23622248
MIRT454746	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT454745	hsa-miR-5688	PAR-CLIP	23592263
MIRT454744	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT454743	hsa-miR-5583-3p	PAR-CLIP	23592263
MIRT454742	hsa-miR-3914	PAR-CLIP	23592263
MIRT454741	hsa-miR-5579-5p	PAR-CLIP	23592263
MIRT454740	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT454739	hsa-miR-222-5p	PAR-CLIP	23592263
MIRT454746	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT454745	hsa-miR-5688	PAR-CLIP	23592263
MIRT454744	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT454743	hsa-miR-5583-3p	PAR-CLIP	23592263
MIRT454742	hsa-miR-3914	PAR-CLIP	23592263
MIRT454741	hsa-miR-5579-5p	PAR-CLIP	23592263
MIRT454740	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT454739	hsa-miR-222-5p	PAR-CLIP	23592263
MIRT1179034	hsa-miR-1208	CLIP-seq
MIRT1179035	hsa-miR-153	CLIP-seq
MIRT1179036	hsa-miR-3145-3p	CLIP-seq
MIRT1179037	hsa-miR-3180-5p	CLIP-seq
MIRT1179038	hsa-miR-3647-3p	CLIP-seq
MIRT1179039	hsa-miR-3689a-5p	CLIP-seq
MIRT1179040	hsa-miR-3689b	CLIP-seq
MIRT1179041	hsa-miR-3689e	CLIP-seq
MIRT1179042	hsa-miR-3689f	CLIP-seq
MIRT1179043	hsa-miR-4420	CLIP-seq
MIRT1179044	hsa-miR-4477a	CLIP-seq
MIRT1179045	hsa-miR-448	CLIP-seq
MIRT1179046	hsa-miR-4684-3p	CLIP-seq
MIRT1179047	hsa-miR-520a-5p	CLIP-seq
MIRT1179048	hsa-miR-525-5p	CLIP-seq
MIRT1179049	hsa-miR-561	CLIP-seq
MIRT1179037	hsa-miR-3180-5p	CLIP-seq
MIRT1179038	hsa-miR-3647-3p	CLIP-seq
MIRT2579328	hsa-miR-4251	CLIP-seq
MIRT2579329	hsa-miR-4303	CLIP-seq
MIRT2579330	hsa-miR-4329	CLIP-seq
MIRT1179044	hsa-miR-4477a	CLIP-seq
MIRT2579331	hsa-miR-4762-3p	CLIP-seq
MIRT2579332	hsa-miR-495	CLIP-seq
MIRT1179047	hsa-miR-520a-5p	CLIP-seq
MIRT1179048	hsa-miR-525-5p	CLIP-seq
MIRT1179049	hsa-miR-561	CLIP-seq
MIRT1179037	hsa-miR-3180-5p	CLIP-seq
MIRT1179038	hsa-miR-3647-3p	CLIP-seq
MIRT2579328	hsa-miR-4251	CLIP-seq
MIRT2579329	hsa-miR-4303	CLIP-seq
MIRT2579330	hsa-miR-4329	CLIP-seq
MIRT1179044	hsa-miR-4477a	CLIP-seq
MIRT2579331	hsa-miR-4762-3p	CLIP-seq
MIRT2579332	hsa-miR-495	CLIP-seq
MIRT1179047	hsa-miR-520a-5p	CLIP-seq
MIRT1179048	hsa-miR-525-5p	CLIP-seq
MIRT1179049	hsa-miR-561	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	TAS	9760212
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	TAS	9760212
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	17209039
GO:0042775	Process	Mitochondrial ATP synthesis coupled electron transport	IBA
GO:0042775	Process	Mitochondrial ATP synthesis coupled electron transport	IMP	24746669
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 17209039, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	IMP	24746669
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603322	7701	ENSG00000165264

Protein

UniProt ID

O95139

Protein name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (Complex I-B17) (CI-B17) (NADH-ubiquinone oxidoreductase B17 subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09782	NDUF_B6	1 → 128	NADH:ubiquinone oxidoreductase, NDUFB6/B17 subunit	Family

Sequence

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKM
VHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM
KEFPDQHH

Sequence length

128

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

NDUFB6 (NADH:ubiquinone oxidoreductase subunit B6)