Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4712
Gene name	NADH:ubiquinone oxidoreductase subunit B6
Gene symbol	NDUFB6
Synonyms (NCBI Gene)	B17CI
Chromosome	9
Chromosome location	9p21.1
Summary	The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase act

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021295	hsa-miR-125a-5p	Sequencing	20371350
MIRT025612	hsa-miR-10a-5p	Sequencing	20371350
MIRT044986	hsa-miR-186-5p	CLASH	23622248
MIRT044986	hsa-miR-186-5p	CLASH	23622248
MIRT454746	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT454745	hsa-miR-5688	PAR-CLIP	23592263
MIRT454744	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT454743	hsa-miR-5583-3p	PAR-CLIP	23592263
MIRT454742	hsa-miR-3914	PAR-CLIP	23592263
MIRT454741	hsa-miR-5579-5p	PAR-CLIP	23592263
MIRT454740	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT454739	hsa-miR-222-5p	PAR-CLIP	23592263
MIRT454746	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT454745	hsa-miR-5688	PAR-CLIP	23592263
MIRT454744	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT454743	hsa-miR-5583-3p	PAR-CLIP	23592263
MIRT454742	hsa-miR-3914	PAR-CLIP	23592263
MIRT454741	hsa-miR-5579-5p	PAR-CLIP	23592263
MIRT454740	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT454739	hsa-miR-222-5p	PAR-CLIP	23592263
MIRT1179034	hsa-miR-1208	CLIP-seq
MIRT1179035	hsa-miR-153	CLIP-seq
MIRT1179036	hsa-miR-3145-3p	CLIP-seq
MIRT1179037	hsa-miR-3180-5p	CLIP-seq
MIRT1179038	hsa-miR-3647-3p	CLIP-seq
MIRT1179039	hsa-miR-3689a-5p	CLIP-seq
MIRT1179040	hsa-miR-3689b	CLIP-seq
MIRT1179041	hsa-miR-3689e	CLIP-seq
MIRT1179042	hsa-miR-3689f	CLIP-seq
MIRT1179043	hsa-miR-4420	CLIP-seq
MIRT1179044	hsa-miR-4477a	CLIP-seq
MIRT1179045	hsa-miR-448	CLIP-seq
MIRT1179046	hsa-miR-4684-3p	CLIP-seq
MIRT1179047	hsa-miR-520a-5p	CLIP-seq
MIRT1179048	hsa-miR-525-5p	CLIP-seq
MIRT1179049	hsa-miR-561	CLIP-seq
MIRT1179037	hsa-miR-3180-5p	CLIP-seq
MIRT1179038	hsa-miR-3647-3p	CLIP-seq
MIRT2579328	hsa-miR-4251	CLIP-seq
MIRT2579329	hsa-miR-4303	CLIP-seq
MIRT2579330	hsa-miR-4329	CLIP-seq
MIRT1179044	hsa-miR-4477a	CLIP-seq
MIRT2579331	hsa-miR-4762-3p	CLIP-seq
MIRT2579332	hsa-miR-495	CLIP-seq
MIRT1179047	hsa-miR-520a-5p	CLIP-seq
MIRT1179048	hsa-miR-525-5p	CLIP-seq
MIRT1179049	hsa-miR-561	CLIP-seq
MIRT1179037	hsa-miR-3180-5p	CLIP-seq
MIRT1179038	hsa-miR-3647-3p	CLIP-seq
MIRT2579328	hsa-miR-4251	CLIP-seq
MIRT2579329	hsa-miR-4303	CLIP-seq
MIRT2579330	hsa-miR-4329	CLIP-seq
MIRT1179044	hsa-miR-4477a	CLIP-seq
MIRT2579331	hsa-miR-4762-3p	CLIP-seq
MIRT2579332	hsa-miR-495	CLIP-seq
MIRT1179047	hsa-miR-520a-5p	CLIP-seq
MIRT1179048	hsa-miR-525-5p	CLIP-seq
MIRT1179049	hsa-miR-561	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	TAS	9760212
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	TAS	9760212
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	17209039
GO:0042775	Process	Mitochondrial ATP synthesis coupled electron transport	IBA
GO:0042775	Process	Mitochondrial ATP synthesis coupled electron transport	IMP	24746669
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 17209039, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	IMP	24746669
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603322	7701	ENSG00000165264

O95139

Protein name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (Complex I-B17) (CI-B17) (NADH-ubiquinone oxidoreductase B17 subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09782	NDUF_B6	1 → 128	NADH:ubiquinone oxidoreductase, NDUFB6/B17 subunit	Family

Sequence

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKM
VHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM
KEFPDQHH

Sequence length

128

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Uncertain significance	rs145570231	RCV005932639

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis	Stimulate	2344212
Carcinoma Renal Cell	Associate	25315157
Congenital heart block	Associate	10446878
Diabetes Mellitus	Associate	17948130
Exfoliation Syndrome	Associate	8695558
Heart Failure	Associate	36782329
Leukemia Myeloid Acute	Associate	38253683
Myoclonic Epilepsy Juvenile	Stimulate	7670762
Myotonic Dystrophy	Associate	38240888
Neoplasm Metastasis	Associate	29992774
Neoplasms	Associate	25315157
Stomach Neoplasms	Associate	29992774

NDUFB6 (NADH:ubiquinone oxidoreductase subunit B6)