Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4710
Gene name	NADH:ubiquinone oxidoreductase subunit B4
Gene symbol	NDUFB4
Synonyms (NCBI Gene)	B15CI-B15
Chromosome	3
Chromosome location	3q13.33
Summary	This gene encodes a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase, the first enzyme complex in the mitochondrial electron transport chain (complex I). Mammalian complex I is composed of 45 different subunits and transfers electr

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028749	hsa-miR-26b-5p	Microarray	19088304
MIRT1178977	hsa-miR-1280	CLIP-seq
MIRT1178978	hsa-miR-1287	CLIP-seq
MIRT1178979	hsa-miR-1976	CLIP-seq
MIRT1178980	hsa-miR-3135b	CLIP-seq
MIRT1178981	hsa-miR-3145-5p	CLIP-seq
MIRT1178982	hsa-miR-323-3p	CLIP-seq
MIRT1178983	hsa-miR-338-5p	CLIP-seq
MIRT1178984	hsa-miR-3607-3p	CLIP-seq
MIRT1178985	hsa-miR-3678-5p	CLIP-seq
MIRT1178986	hsa-miR-370	CLIP-seq
MIRT1178987	hsa-miR-3978	CLIP-seq
MIRT1178988	hsa-miR-4652-3p	CLIP-seq
MIRT1178989	hsa-miR-4764-3p	CLIP-seq
MIRT1178990	hsa-miR-4768-5p	CLIP-seq
MIRT1178991	hsa-miR-494	CLIP-seq
MIRT1178992	hsa-miR-515-5p	CLIP-seq
MIRT1178993	hsa-miR-548k	CLIP-seq
MIRT1178994	hsa-miR-548n	CLIP-seq
MIRT1178995	hsa-miR-548u	CLIP-seq
MIRT1178996	hsa-miR-570	CLIP-seq
MIRT1178997	hsa-miR-875-3p	CLIP-seq
MIRT1178998	hsa-miR-1202	CLIP-seq
MIRT1178999	hsa-miR-3972	CLIP-seq
MIRT1179000	hsa-miR-4317	CLIP-seq
MIRT2051763	hsa-miR-3646	CLIP-seq
MIRT1178998	hsa-miR-1202	CLIP-seq
MIRT2280899	hsa-miR-2682	CLIP-seq
MIRT1178999	hsa-miR-3972	CLIP-seq
MIRT1179000	hsa-miR-4317	CLIP-seq
MIRT2280900	hsa-miR-4423-3p	CLIP-seq
MIRT2280901	hsa-miR-449c	CLIP-seq
MIRT2280902	hsa-miR-940	CLIP-seq
MIRT1178995	hsa-miR-548u	CLIP-seq
MIRT1178978	hsa-miR-1287	CLIP-seq
MIRT1178979	hsa-miR-1976	CLIP-seq
MIRT1178980	hsa-miR-3135b	CLIP-seq
MIRT1178986	hsa-miR-370	CLIP-seq
MIRT1178987	hsa-miR-3978	CLIP-seq
MIRT2579321	hsa-miR-4733-5p	CLIP-seq
MIRT2579322	hsa-miR-548aa	CLIP-seq
MIRT2579323	hsa-miR-577	CLIP-seq
MIRT1178997	hsa-miR-875-3p	CLIP-seq
MIRT1178978	hsa-miR-1287	CLIP-seq
MIRT1178979	hsa-miR-1976	CLIP-seq
MIRT1178980	hsa-miR-3135b	CLIP-seq
MIRT1178986	hsa-miR-370	CLIP-seq
MIRT1178987	hsa-miR-3978	CLIP-seq
MIRT1178988	hsa-miR-4652-3p	CLIP-seq
MIRT1178989	hsa-miR-4764-3p	CLIP-seq
MIRT1178996	hsa-miR-570	CLIP-seq
MIRT2579323	hsa-miR-577	CLIP-seq
MIRT1178997	hsa-miR-875-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603840	7699	ENSG00000065518

O95168

Protein name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Complex I-B15) (CI-B15) (NADH-ubiquinone oxidoreductase B15 subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07225	NDUF_B4	5 → 128	NADH-ubiquinone oxidoreductase B15 subunit (NDUFB4)	Family

Sequence

MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLI
ENPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK
LDRTFHLSY

Sequence length

129

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Anemia Sickle Cell	Associate	10651741	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	10651741, 1299245	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	6746903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	3578273	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Stimulate	6594040	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	38042639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Stimulate	22784404	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	22370889	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Associate	37653517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	33607292	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Stimulate	27268619	★★★★★ ★☆☆☆☆ Found in Text Mining only

NDUFB4 (NADH:ubiquinone oxidoreductase subunit B4)