Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4702
Gene name	NADH:ubiquinone oxidoreductase subunit A8
Gene symbol	NDUFA8
Synonyms (NCBI Gene)	CI-19KDCI-PGIVMC1DN37PGIV
Chromosome	9
Chromosome location	9q33.2
Summary	The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments
MIRT1178876	hsa-miR-224	CLIP-seq
MIRT1178877	hsa-miR-3691-3p	CLIP-seq
MIRT1178878	hsa-miR-4265	CLIP-seq
MIRT1178879	hsa-miR-4296	CLIP-seq
MIRT1178880	hsa-miR-4322	CLIP-seq
MIRT1178881	hsa-miR-4417	CLIP-seq
MIRT1178882	hsa-miR-4480	CLIP-seq
MIRT1178883	hsa-miR-4520a-3p	CLIP-seq
MIRT1178884	hsa-miR-4640-5p	CLIP-seq
MIRT1178885	hsa-miR-4726-5p	CLIP-seq
MIRT1178886	hsa-miR-522	CLIP-seq
MIRT1178887	hsa-miR-574-5p	CLIP-seq
MIRT1178888	hsa-miR-711	CLIP-seq
MIRT2051750	hsa-miR-129-5p	CLIP-seq
MIRT2051751	hsa-miR-2053	CLIP-seq
MIRT1178876	hsa-miR-224	CLIP-seq
MIRT1178877	hsa-miR-3691-3p	CLIP-seq
MIRT2051752	hsa-miR-409-3p	CLIP-seq
MIRT1178882	hsa-miR-4480	CLIP-seq
MIRT2051753	hsa-miR-569	CLIP-seq
MIRT2051750	hsa-miR-129-5p	CLIP-seq
MIRT2051751	hsa-miR-2053	CLIP-seq
MIRT1178876	hsa-miR-224	CLIP-seq
MIRT2280852	hsa-miR-3133	CLIP-seq
MIRT1178877	hsa-miR-3691-3p	CLIP-seq
MIRT2051752	hsa-miR-409-3p	CLIP-seq
MIRT1178882	hsa-miR-4480	CLIP-seq
MIRT2051753	hsa-miR-569	CLIP-seq
MIRT2280853	hsa-miR-603	CLIP-seq
MIRT2280854	hsa-miR-758	CLIP-seq
MIRT2391465	hsa-miR-1231	CLIP-seq
MIRT2391466	hsa-miR-1268	CLIP-seq
MIRT2391467	hsa-miR-1268b	CLIP-seq
MIRT2391468	hsa-miR-3663-3p	CLIP-seq
MIRT2391469	hsa-miR-4288	CLIP-seq
MIRT2391470	hsa-miR-4303	CLIP-seq
MIRT2391471	hsa-miR-585	CLIP-seq
MIRT2391472	hsa-miR-632	CLIP-seq
MIRT2051750	hsa-miR-129-5p	CLIP-seq
MIRT2051751	hsa-miR-2053	CLIP-seq
MIRT2051752	hsa-miR-409-3p	CLIP-seq
MIRT2051753	hsa-miR-569	CLIP-seq
MIRT2280854	hsa-miR-758	CLIP-seq
MIRT2051750	hsa-miR-129-5p	CLIP-seq
MIRT2051751	hsa-miR-2053	CLIP-seq
MIRT2051752	hsa-miR-409-3p	CLIP-seq
MIRT2051753	hsa-miR-569	CLIP-seq
MIRT2280854	hsa-miR-758	CLIP-seq
MIRT2051750	hsa-miR-129-5p	CLIP-seq
MIRT2051751	hsa-miR-2053	CLIP-seq
MIRT1178876	hsa-miR-224	CLIP-seq
MIRT1178877	hsa-miR-3691-3p	CLIP-seq
MIRT2051752	hsa-miR-409-3p	CLIP-seq
MIRT1178882	hsa-miR-4480	CLIP-seq
MIRT2051753	hsa-miR-569	CLIP-seq
MIRT2280854	hsa-miR-758	CLIP-seq
MIRT2051750	hsa-miR-129-5p	CLIP-seq
MIRT2051751	hsa-miR-2053	CLIP-seq
MIRT1178876	hsa-miR-224	CLIP-seq
MIRT1178877	hsa-miR-3691-3p	CLIP-seq
MIRT2051752	hsa-miR-409-3p	CLIP-seq
MIRT1178882	hsa-miR-4480	CLIP-seq
MIRT2051753	hsa-miR-569	CLIP-seq
MIRT2280854	hsa-miR-758	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21310150, 27499296, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	23676665
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005758	Component	Mitochondrial intermembrane space	IDA	21310150
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	TAS	9860297
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603359	7692	ENSG00000119421

P51970

Protein name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 (Complex I-19kD) (CI-19kD) (Complex I-PGIV) (CI-PGIV) (NADH-ubiquinone oxidoreductase 19 kDa subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis (PubMed:27626371, PubMed:32385911, PubMed:33153867). Complex I functions in the transfer of electr

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06747	CHCH	78 → 113	CHCH domain	Domain

Sequence

MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEG
KLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRP
DLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK

Sequence length

172

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Mitochondrial complex I deficiency, nuclear type 37	Pathogenic; Likely pathogenic	rs767864225, rs1319414797, rs760549929	RCV001374462 RCV001374463 RCV002226921

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	36077333
Mitochondrial complex I deficiency	Associate	15576045
Mitochondrial Encephalomyopathies	Associate	15576045

NDUFA8 (NADH:ubiquinone oxidoreductase subunit A8)