Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4700
Gene name Gene Name - the full gene name approved by the HGNC.
NADH:ubiquinone oxidoreductase subunit A6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NDUFA6
Synonyms (NCBI Gene) Gene synonyms aliases
B14, CI-B14, LYRM6, MC1DN33, NADHB14
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MC1DN33
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the LYR family of proteins that contain a highly conserved tripeptide (LYR) motif near the N-terminus. The encoded protein is an accessory subunit of NADH: ubiquinone oxidorerductase (Complex I), which is the largest enzyme o
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs750830935 C>G,T Pathogenic Coding sequence variant, missense variant
rs758833609 C>A,T Pathogenic Coding sequence variant, missense variant, stop gained
rs763006208 A>- Pathogenic Frameshift variant, coding sequence variant
rs781099275 G>- Pathogenic Frameshift variant, coding sequence variant
rs1569463838 CT>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT549542 hsa-miR-3174 PAR-CLIP 20371350
MIRT549541 hsa-miR-520f-5p PAR-CLIP 20371350
MIRT549540 hsa-miR-591 PAR-CLIP 20371350
MIRT549539 hsa-miR-1301-5p PAR-CLIP 20371350
MIRT549538 hsa-miR-6502-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005743 Component Mitochondrial inner membrane TAS
GO:0005747 Component Mitochondrial respiratory chain complex I IBA 21873635
GO:0005747 Component Mitochondrial respiratory chain complex I IDA 12611891, 17209039, 27626371
GO:0005747 Component Mitochondrial respiratory chain complex I NAS 9878551
GO:0006120 Process Mitochondrial electron transport, NADH to ubiquinone NAS 9878551
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602138 7690 ENSG00000184983
Protein
UniProt ID P56556
Protein name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (Complex I-B14) (CI-B14) (LYR motif-containing protein 6) (NADH-ubiquinone oxidoreductase B14 subunit)
Protein function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Required for proper complex I assembly (PubMed:30245030). Complex I functions in the transfer of
PDB 5XTB , 5XTD , 5XTH , 5XTI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05347 Complex1_LYR 30 92 Complex 1 protein (LYR family) Family
Sequence
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR
DKVREMFMKNAHVTDPRVVDLLVIKGKIELEE
TIKVWKQRTHVMRFFHETEAPRPKDFLS
KFYVGHDP
Sequence length 128
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
  Respiratory electron transport
Complex I biogenesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Diabetes mellitus Diabetes Mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
Epileptic encephalopathy Encephalopathies rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625
View all (860 more)
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Mitochondrial Complex Deficiency mitochondrial complex 1 deficiency, nuclear type 33, mitochondrial complex I deficiency GenCC
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency Associate 18187875, 3001309
Diabetes Mellitus Type 1 Stimulate 31127057
Disease Associate 4352462
Hemochromatosis Associate 3475981
HIV Infections Associate 24797997
IgA Deficiency Associate 19052350
Infections Associate 8709196
Inflammation Inhibit 18704168
Leukemia Myelogenous Chronic BCR ABL Positive Associate 12879429
Lung Neoplasms Associate 29129073