NDUFA3 (NADH:ubiquinone oxidoreductase subunit A3)

Gene

• Entrez ID: 4696
• Gene name: NADH:ubiquinone oxidoreductase subunit A3
• Gene symbol: NDUFA3
• Synonyms (NCBI Gene): B9, CI-B9
• Chromosome: 19
• Chromosome location: 19q13.42

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051531	hsa-let-7e-5p	CLASH	23622248
MIRT044766	hsa-miR-320a	CLASH	23622248
MIRT039275	hsa-miR-671-5p	CLASH	23622248
MIRT039275	hsa-miR-671-5p	CLASH	23622248
MIRT039275	hsa-miR-671-5p	CLASH	23622248
MIRT1178679	hsa-miR-23a	CLIP-seq
MIRT1178680	hsa-miR-23b	CLIP-seq
MIRT1178681	hsa-miR-23c	CLIP-seq
MIRT1178682	hsa-miR-3689a-3p	CLIP-seq
MIRT1178683	hsa-miR-3689c	CLIP-seq
MIRT1178684	hsa-miR-4300	CLIP-seq
MIRT1178685	hsa-miR-5096	CLIP-seq
MIRT1178686	hsa-miR-920	CLIP-seq
MIRT2051722	hsa-miR-3184	CLIP-seq
MIRT1178682	hsa-miR-3689a-3p	CLIP-seq
MIRT1178683	hsa-miR-3689c	CLIP-seq
MIRT2051723	hsa-miR-423-5p	CLIP-seq
MIRT1178684	hsa-miR-4300	CLIP-seq
MIRT2051724	hsa-miR-4728-5p	CLIP-seq
MIRT1178686	hsa-miR-920	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005747	Component	Mitochondrial respiratory chain complex I	IBA	21873635
GO:0005747	Component	Mitochondrial respiratory chain complex I	IDA	12611891, 27626371
GO:0005747	Component	Mitochondrial respiratory chain complex I	NAS	9878551
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	TAS
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0016021	Component	Integral component of membrane	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	27626371
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	TAS

Other IDs

• MIM: 603832
• HGNC: 7686
• e!Ensembl: ENSG00000170906

Protein

• UniProt ID: O95167
• Protein name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 (Complex I-B9) (CI-B9) (NADH-ubiquinone oxidoreductase B9 subunit)
• Protein function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat
• PDB: 5XTC, 5XTD, 5XTH, 5XTI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14987	NADHdh_A3	7 → 84	NADH dehydrogenase 1 alpha subcomplex subunit 3	Family

• Sequence:

  MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD
  GNMPDVPSHPQDPQGPSLEWLKKL

• Sequence length: 84

Pathways

KEGG:

Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Reactome:

Respiratory electron transport
Complex I biogenesis

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243

Unknown
Disease term	Disease name	Evidence	References	Source
Leigh Syndrome	Leigh syndrome			GenCC

Associations from Text Mining
Disease Name	Relationship Type	References
Arrhythmias Cardiac	Associate	32077934
beta Thalassemia	Associate	3955238
Carcinoma Non Small Cell Lung	Associate	39506771
delta Thalassemia	Associate	3955238
Diabetes Mellitus Type 1	Associate	33893332