Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4696
Gene name	NADH:ubiquinone oxidoreductase subunit A3
Gene symbol	NDUFA3
Synonyms (NCBI Gene)	B9CI-B9
Chromosome	19
Chromosome location	19q13.42

Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051531	hsa-let-7e-5p	CLASH	23622248
MIRT044766	hsa-miR-320a	CLASH	23622248
MIRT039275	hsa-miR-671-5p	CLASH	23622248
MIRT039275	hsa-miR-671-5p	CLASH	23622248
MIRT039275	hsa-miR-671-5p	CLASH	23622248
MIRT1178679	hsa-miR-23a	CLIP-seq
MIRT1178680	hsa-miR-23b	CLIP-seq
MIRT1178681	hsa-miR-23c	CLIP-seq
MIRT1178682	hsa-miR-3689a-3p	CLIP-seq
MIRT1178683	hsa-miR-3689c	CLIP-seq
MIRT1178684	hsa-miR-4300	CLIP-seq
MIRT1178685	hsa-miR-5096	CLIP-seq
MIRT1178686	hsa-miR-920	CLIP-seq
MIRT2051722	hsa-miR-3184	CLIP-seq
MIRT1178682	hsa-miR-3689a-3p	CLIP-seq
MIRT1178683	hsa-miR-3689c	CLIP-seq
MIRT2051723	hsa-miR-423-5p	CLIP-seq
MIRT1178684	hsa-miR-4300	CLIP-seq
MIRT2051724	hsa-miR-4728-5p	CLIP-seq
MIRT1178686	hsa-miR-920	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 35271311
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	9878551
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	9878551
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 27626371
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	9878551
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603832	7686	ENSG00000170906

O95167

Protein name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 (Complex I-B9) (CI-B9) (NADH-ubiquinone oxidoreductase B9 subunit)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14987	NADHdh_A3	7 → 84	NADH dehydrogenase 1 alpha subcomplex subunit 3	Family

Sequence

MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD
GNMPDVPSHPQDPQGPSLEWLKKL

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

NDUFA3 (NADH:ubiquinone oxidoreductase subunit A3)