Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4691
Gene name Gene Name - the full gene name approved by the HGNC.	Nucleolin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NCL
Synonyms (NCBI Gene) Gene synonyms aliases	C23, Nsr1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately

Show/Hide all(327)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005204	hsa-miR-30a-5p	pSILAC	18668040
MIRT005204	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT049002	hsa-miR-92a-3p	CLASH	23622248
MIRT048058	hsa-miR-197-3p	CLASH	23622248
MIRT046909	hsa-miR-221-3p	CLASH	23622248
MIRT041552	hsa-miR-193b-3p	CLASH	23622248
MIRT040534	hsa-miR-92b-3p	CLASH	23622248
MIRT040493	hsa-miR-598-3p	CLASH	23622248
MIRT040493	hsa-miR-598-3p	CLASH	23622248
MIRT039947	hsa-miR-615-3p	CLASH	23622248
MIRT037670	hsa-miR-744-5p	CLASH	23622248
MIRT036889	hsa-miR-877-3p	CLASH	23622248
MIRT571878	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT571878	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT205596	hsa-miR-548aa	PAR-CLIP	20371350
MIRT205597	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT205594	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT571877	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT571875	hsa-miR-4780	PAR-CLIP	20371350
MIRT571876	hsa-miR-938	PAR-CLIP	20371350
MIRT571874	hsa-miR-6886-3p	PAR-CLIP	20371350
MIRT571873	hsa-miR-5681b	PAR-CLIP	20371350
MIRT571872	hsa-miR-3157-3p	PAR-CLIP	20371350
MIRT571871	hsa-miR-874-3p	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT547352	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT547351	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT547349	hsa-miR-942-3p	PAR-CLIP	20371350
MIRT547348	hsa-miR-4496	PAR-CLIP	20371350
MIRT547347	hsa-miR-3148	PAR-CLIP	20371350
MIRT547346	hsa-miR-8065	PAR-CLIP	20371350
MIRT205586	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT547344	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT547342	hsa-miR-3674	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT547352	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT547351	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT561864	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT547349	hsa-miR-942-3p	PAR-CLIP	20371350
MIRT547348	hsa-miR-4496	PAR-CLIP	20371350
MIRT561863	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT547347	hsa-miR-3148	PAR-CLIP	20371350
MIRT561862	hsa-miR-5187-5p	PAR-CLIP	20371350
MIRT547346	hsa-miR-8065	PAR-CLIP	20371350
MIRT561861	hsa-miR-6728-5p	PAR-CLIP	20371350
MIRT205586	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT547344	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT547342	hsa-miR-3674	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT547352	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT547351	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT561864	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT547349	hsa-miR-942-3p	PAR-CLIP	20371350
MIRT547348	hsa-miR-4496	PAR-CLIP	20371350
MIRT561863	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT547347	hsa-miR-3148	PAR-CLIP	20371350
MIRT561862	hsa-miR-5187-5p	PAR-CLIP	20371350
MIRT547346	hsa-miR-8065	PAR-CLIP	20371350
MIRT561861	hsa-miR-6728-5p	PAR-CLIP	20371350
MIRT205586	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT547344	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT547342	hsa-miR-3674	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT547352	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT547351	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	21572407
MIRT547349	hsa-miR-942-3p	PAR-CLIP	21572407
MIRT547348	hsa-miR-4496	PAR-CLIP	21572407
MIRT547347	hsa-miR-3148	PAR-CLIP	21572407
MIRT547346	hsa-miR-8065	PAR-CLIP	21572407
MIRT205586	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT547344	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	21572407
MIRT547342	hsa-miR-3674	PAR-CLIP	21572407
MIRT547347	hsa-miR-3148	PAR-CLIP	27292025
MIRT571878	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT571878	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT205596	hsa-miR-548aa	PAR-CLIP	20371350
MIRT205597	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT205594	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT571877	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT571875	hsa-miR-4780	PAR-CLIP	20371350
MIRT571876	hsa-miR-938	PAR-CLIP	20371350
MIRT571874	hsa-miR-6886-3p	PAR-CLIP	20371350
MIRT571873	hsa-miR-5681b	PAR-CLIP	20371350
MIRT571872	hsa-miR-3157-3p	PAR-CLIP	20371350
MIRT571871	hsa-miR-874-3p	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT547352	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT547351	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT547349	hsa-miR-942-3p	PAR-CLIP	20371350
MIRT547348	hsa-miR-4496	PAR-CLIP	20371350
MIRT547347	hsa-miR-3148	PAR-CLIP	20371350
MIRT547346	hsa-miR-8065	PAR-CLIP	20371350
MIRT205586	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT547344	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT547342	hsa-miR-3674	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT547352	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT547351	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT561864	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT547349	hsa-miR-942-3p	PAR-CLIP	20371350
MIRT547348	hsa-miR-4496	PAR-CLIP	20371350
MIRT561863	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT547347	hsa-miR-3148	PAR-CLIP	20371350
MIRT561862	hsa-miR-5187-5p	PAR-CLIP	20371350
MIRT547346	hsa-miR-8065	PAR-CLIP	20371350
MIRT561861	hsa-miR-6728-5p	PAR-CLIP	20371350
MIRT205586	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT547344	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT547342	hsa-miR-3674	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT547352	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT547351	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT561864	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT547349	hsa-miR-942-3p	PAR-CLIP	20371350
MIRT547348	hsa-miR-4496	PAR-CLIP	20371350
MIRT561863	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT547347	hsa-miR-3148	PAR-CLIP	20371350
MIRT561862	hsa-miR-5187-5p	PAR-CLIP	20371350
MIRT547346	hsa-miR-8065	PAR-CLIP	20371350
MIRT561861	hsa-miR-6728-5p	PAR-CLIP	20371350
MIRT205586	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT547344	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT547342	hsa-miR-3674	PAR-CLIP	20371350
MIRT547353	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT547352	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT547351	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT547350	hsa-miR-4802-3p	PAR-CLIP	21572407
MIRT547349	hsa-miR-942-3p	PAR-CLIP	21572407
MIRT547348	hsa-miR-4496	PAR-CLIP	21572407
MIRT547347	hsa-miR-3148	PAR-CLIP	21572407
MIRT547346	hsa-miR-8065	PAR-CLIP	21572407
MIRT205586	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT547345	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT547344	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT547343	hsa-miR-135b-3p	PAR-CLIP	21572407
MIRT547342	hsa-miR-3674	PAR-CLIP	21572407
MIRT1176554	hsa-miR-1	CLIP-seq
MIRT1176555	hsa-miR-1323	CLIP-seq
MIRT1176556	hsa-miR-140-3p	CLIP-seq
MIRT1176557	hsa-miR-203	CLIP-seq
MIRT1176558	hsa-miR-206	CLIP-seq
MIRT1176559	hsa-miR-219-1-3p	CLIP-seq
MIRT1176560	hsa-miR-2355-3p	CLIP-seq
MIRT1176561	hsa-miR-2467-3p	CLIP-seq
MIRT1176562	hsa-miR-3126-5p	CLIP-seq
MIRT1176563	hsa-miR-3128	CLIP-seq
MIRT1176564	hsa-miR-3167	CLIP-seq
MIRT1176565	hsa-miR-3169	CLIP-seq
MIRT1176566	hsa-miR-34c-3p	CLIP-seq
MIRT1176567	hsa-miR-3673	CLIP-seq
MIRT1176568	hsa-miR-383	CLIP-seq
MIRT1176569	hsa-miR-3909	CLIP-seq
MIRT1176570	hsa-miR-431	CLIP-seq
MIRT1176571	hsa-miR-432	CLIP-seq
MIRT1176572	hsa-miR-4428	CLIP-seq
MIRT1176573	hsa-miR-4646-3p	CLIP-seq
MIRT1176574	hsa-miR-4700-3p	CLIP-seq
MIRT1176575	hsa-miR-4720-5p	CLIP-seq
MIRT1176576	hsa-miR-4772-5p	CLIP-seq
MIRT1176577	hsa-miR-4775	CLIP-seq
MIRT1176578	hsa-miR-4786-5p	CLIP-seq
MIRT1176579	hsa-miR-4799-3p	CLIP-seq
MIRT1176580	hsa-miR-483-5p	CLIP-seq
MIRT1176581	hsa-miR-494	CLIP-seq
MIRT1176582	hsa-miR-522	CLIP-seq
MIRT1176583	hsa-miR-548ac	CLIP-seq
MIRT1176584	hsa-miR-548d-3p	CLIP-seq
MIRT1176585	hsa-miR-548o	CLIP-seq
MIRT1176586	hsa-miR-548p	CLIP-seq
MIRT1176587	hsa-miR-548z	CLIP-seq
MIRT1176588	hsa-miR-561	CLIP-seq
MIRT1176589	hsa-miR-600	CLIP-seq
MIRT1176590	hsa-miR-613	CLIP-seq
MIRT1176591	hsa-miR-616	CLIP-seq
MIRT1176592	hsa-miR-676	CLIP-seq
MIRT1176593	hsa-miR-760	CLIP-seq
MIRT1176594	hsa-miR-874	CLIP-seq
MIRT1176595	hsa-miR-876-5p	CLIP-seq
MIRT1176554	hsa-miR-1	CLIP-seq
MIRT2051144	hsa-miR-105	CLIP-seq
MIRT2051145	hsa-miR-132	CLIP-seq
MIRT1176555	hsa-miR-1323	CLIP-seq
MIRT1176556	hsa-miR-140-3p	CLIP-seq
MIRT2051146	hsa-miR-194	CLIP-seq
MIRT1176557	hsa-miR-203	CLIP-seq
MIRT1176558	hsa-miR-206	CLIP-seq
MIRT2051147	hsa-miR-212	CLIP-seq
MIRT1176559	hsa-miR-219-1-3p	CLIP-seq
MIRT1176560	hsa-miR-2355-3p	CLIP-seq
MIRT1176561	hsa-miR-2467-3p	CLIP-seq
MIRT1176562	hsa-miR-3126-5p	CLIP-seq
MIRT1176563	hsa-miR-3128	CLIP-seq
MIRT2051148	hsa-miR-3160-5p	CLIP-seq
MIRT1176564	hsa-miR-3167	CLIP-seq
MIRT1176565	hsa-miR-3169	CLIP-seq
MIRT1176566	hsa-miR-34c-3p	CLIP-seq
MIRT1176567	hsa-miR-3673	CLIP-seq
MIRT1176568	hsa-miR-383	CLIP-seq
MIRT1176569	hsa-miR-3909	CLIP-seq
MIRT1176570	hsa-miR-431	CLIP-seq
MIRT1176571	hsa-miR-432	CLIP-seq
MIRT1176572	hsa-miR-4428	CLIP-seq
MIRT1176573	hsa-miR-4646-3p	CLIP-seq
MIRT1176574	hsa-miR-4700-3p	CLIP-seq
MIRT1176575	hsa-miR-4720-5p	CLIP-seq
MIRT1176576	hsa-miR-4772-5p	CLIP-seq
MIRT1176577	hsa-miR-4775	CLIP-seq
MIRT1176578	hsa-miR-4786-5p	CLIP-seq
MIRT1176579	hsa-miR-4799-3p	CLIP-seq
MIRT1176580	hsa-miR-483-5p	CLIP-seq
MIRT2051149	hsa-miR-543	CLIP-seq
MIRT1176583	hsa-miR-548ac	CLIP-seq
MIRT2051150	hsa-miR-548ae	CLIP-seq
MIRT2051151	hsa-miR-548aj	CLIP-seq
MIRT2051152	hsa-miR-548am	CLIP-seq
MIRT1176584	hsa-miR-548d-3p	CLIP-seq
MIRT1176585	hsa-miR-548o	CLIP-seq
MIRT1176586	hsa-miR-548p	CLIP-seq
MIRT2051153	hsa-miR-548x	CLIP-seq
MIRT1176587	hsa-miR-548z	CLIP-seq
MIRT1176590	hsa-miR-613	CLIP-seq
MIRT1176591	hsa-miR-616	CLIP-seq
MIRT1176592	hsa-miR-676	CLIP-seq
MIRT1176593	hsa-miR-760	CLIP-seq
MIRT1176594	hsa-miR-874	CLIP-seq
MIRT1176595	hsa-miR-876-5p	CLIP-seq
MIRT1176554	hsa-miR-1	CLIP-seq
MIRT1176555	hsa-miR-1323	CLIP-seq
MIRT1176556	hsa-miR-140-3p	CLIP-seq
MIRT1176557	hsa-miR-203	CLIP-seq
MIRT1176558	hsa-miR-206	CLIP-seq
MIRT1176559	hsa-miR-219-1-3p	CLIP-seq
MIRT1176560	hsa-miR-2355-3p	CLIP-seq
MIRT1176561	hsa-miR-2467-3p	CLIP-seq
MIRT1176562	hsa-miR-3126-5p	CLIP-seq
MIRT1176564	hsa-miR-3167	CLIP-seq
MIRT1176565	hsa-miR-3169	CLIP-seq
MIRT1176566	hsa-miR-34c-3p	CLIP-seq
MIRT1176567	hsa-miR-3673	CLIP-seq
MIRT1176568	hsa-miR-383	CLIP-seq
MIRT1176569	hsa-miR-3909	CLIP-seq
MIRT1176570	hsa-miR-431	CLIP-seq
MIRT1176571	hsa-miR-432	CLIP-seq
MIRT1176572	hsa-miR-4428	CLIP-seq
MIRT1176573	hsa-miR-4646-3p	CLIP-seq
MIRT1176574	hsa-miR-4700-3p	CLIP-seq
MIRT1176576	hsa-miR-4772-5p	CLIP-seq
MIRT1176577	hsa-miR-4775	CLIP-seq
MIRT1176578	hsa-miR-4786-5p	CLIP-seq
MIRT1176580	hsa-miR-483-5p	CLIP-seq
MIRT1176583	hsa-miR-548ac	CLIP-seq
MIRT1176584	hsa-miR-548d-3p	CLIP-seq
MIRT1176585	hsa-miR-548o	CLIP-seq
MIRT1176586	hsa-miR-548p	CLIP-seq
MIRT1176587	hsa-miR-548z	CLIP-seq
MIRT1176588	hsa-miR-561	CLIP-seq
MIRT1176589	hsa-miR-600	CLIP-seq
MIRT1176590	hsa-miR-613	CLIP-seq
MIRT1176591	hsa-miR-616	CLIP-seq
MIRT1176592	hsa-miR-676	CLIP-seq
MIRT1176593	hsa-miR-760	CLIP-seq
MIRT1176594	hsa-miR-874	CLIP-seq
MIRT1176595	hsa-miR-876-5p	CLIP-seq
MIRT1176555	hsa-miR-1323	CLIP-seq
MIRT1176557	hsa-miR-203	CLIP-seq
MIRT1176559	hsa-miR-219-1-3p	CLIP-seq
MIRT1176560	hsa-miR-2355-3p	CLIP-seq
MIRT1176561	hsa-miR-2467-3p	CLIP-seq
MIRT1176562	hsa-miR-3126-5p	CLIP-seq
MIRT1176564	hsa-miR-3167	CLIP-seq
MIRT1176573	hsa-miR-4646-3p	CLIP-seq
MIRT1176577	hsa-miR-4775	CLIP-seq
MIRT1176585	hsa-miR-548o	CLIP-seq
MIRT1176592	hsa-miR-676	CLIP-seq
MIRT1176594	hsa-miR-874	CLIP-seq
MIRT1176595	hsa-miR-876-5p	CLIP-seq
MIRT1176566	hsa-miR-34c-3p	CLIP-seq
MIRT1176566	hsa-miR-34c-3p	CLIP-seq
MIRT1176555	hsa-miR-1323	CLIP-seq
MIRT1176559	hsa-miR-219-1-3p	CLIP-seq
MIRT1176560	hsa-miR-2355-3p	CLIP-seq
MIRT2051148	hsa-miR-3160-5p	CLIP-seq
MIRT1176566	hsa-miR-34c-3p	CLIP-seq
MIRT1176573	hsa-miR-4646-3p	CLIP-seq
MIRT1176577	hsa-miR-4775	CLIP-seq
MIRT2051149	hsa-miR-543	CLIP-seq
MIRT1176583	hsa-miR-548ac	CLIP-seq
MIRT1176584	hsa-miR-548d-3p	CLIP-seq
MIRT1176585	hsa-miR-548o	CLIP-seq
MIRT1176586	hsa-miR-548p	CLIP-seq
MIRT1176587	hsa-miR-548z	CLIP-seq
MIRT1176588	hsa-miR-561	CLIP-seq
MIRT1176592	hsa-miR-676	CLIP-seq
MIRT1176559	hsa-miR-219-1-3p	CLIP-seq
MIRT1176560	hsa-miR-2355-3p	CLIP-seq
MIRT2051148	hsa-miR-3160-5p	CLIP-seq
MIRT1176566	hsa-miR-34c-3p	CLIP-seq
MIRT1176573	hsa-miR-4646-3p	CLIP-seq
MIRT1176577	hsa-miR-4775	CLIP-seq
MIRT2051149	hsa-miR-543	CLIP-seq
MIRT1176583	hsa-miR-548ac	CLIP-seq
MIRT1176584	hsa-miR-548d-3p	CLIP-seq
MIRT1176586	hsa-miR-548p	CLIP-seq
MIRT1176587	hsa-miR-548z	CLIP-seq
MIRT1176588	hsa-miR-561	CLIP-seq
MIRT1176592	hsa-miR-676	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
MYBL1	Unknown	10660576
MYBL2	Unknown	10660576

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	16403913
GO:0001533	Component	Cornified envelope	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	8321232
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	2737305
GO:0005515	Function	Protein binding	IPI	12147681, 12427757, 15064750, 15161933, 15674325, 16213212, 16403913, 16648475, 16777843, 17615292, 17620599, 18292223, 18457437, 19174163, 19393617, 19515850, 19877579, 20195357, 20221403, 20858735, 21081503, 21242313, 21281639, 22103682, 22113938, 23972994, 24515436, 24658146, 249
GO:0005634	Component	Nucleus	IDA	15121898, 24071584
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	23353999
GO:0005654	Component	Nucleoplasm	IEA
GO:0005681	Component	Spliceosomal complex	IBA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA	12944467, 19393617, 24071584
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	TAS	2394707
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IDA	16403913
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0017148	Process	Negative regulation of translation	IMP	16213212
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0042162	Function	Telomeric DNA binding	IDA	8321232
GO:0042731	Function	PH domain binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21575138
GO:0043560	Function	Insulin receptor substrate binding	IEA
GO:0044547	Function	DNA topoisomerase binding	IPI	8567649
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0048026	Process	Positive regulation of mRNA splicing, via spliceosome	IBA
GO:0048027	Function	MRNA 5'-UTR binding	IDA	16213212
GO:0051252	Process	Regulation of RNA metabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0160056	Component	Macropinosome membrane	TAS
GO:1901838	Process	Positive regulation of transcription of nucleolar large rRNA by RNA polymerase I	IMP	24071584
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661, 18809582

MIM	HGNC	e!Ensembl
164035	7667	ENSG00000115053

Protein

UniProt ID

P19338

Protein name

Nucleolin (Protein C23)

Protein function

Nucleolin is the major nucleolar protein of growing eukaryotic cells. It is found associated with intranucleolar chromatin and pre-ribosomal particles. It induces chromatin decondensation by binding to histone H1. It is thought to play a role in

PDB

2FC8 , 2FC9 , 2KRR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	309 → 377	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	395 → 460	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	488 → 554	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	574 → 641	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Sequence

MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATS
AKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVA
TPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAA
APASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEE
DDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEG
TEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDL
EKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNST
WSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEAL
NSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARI
VTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGR
GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE

Sequence length

710

Interactions

View interactions

	KEGG		Reactome
	Pathogenic Escherichia coli infection		Major pathway of rRNA processing in the nucleolus and cytosol

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Attention Deficit Hyperactivity Disorder	Attention deficit hyperactivity disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (103)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	37058032
Adenocarcinoma	Associate	32671956
Adenocarcinoma of Lung	Associate	25921135, 32671956
Alzheimer Disease	Associate	26512942, 33910019
Anorchia	Associate	26539909
Arthritis Rheumatoid	Associate	34177888
Autism Spectrum Disorder	Associate	35052391
Autistic Disorder	Associate	35052391
Autoimmune Diseases	Associate	38489184
Brain Neoplasms	Associate	18701711
Breast Neoplasms	Associate	15161050, 18225556, 19363676, 20075200, 27542246, 36499249
Burkitt Lymphoma	Associate	31127617
Calcinosis Cutis	Associate	24242861, 35682908
Carcinogenesis	Associate	12391018, 21998300, 25938538, 30839063, 35682908
Carcinoma Ductal Breast	Associate	18225556
Carcinoma Embryonal	Associate	31513277
Carcinoma Hepatocellular	Associate	25230759, 25938538, 35318110, 39732660, 40153827
Carcinoma Non Small Cell Lung	Associate	23382938, 25921135, 26846099, 28542563, 36478492
Carcinoma Renal Cell	Associate	24242861
Carcinoma Transitional Cell	Associate	37058032
Carcinosarcoma	Stimulate	35682908
Cardiovascular Diseases	Associate	17626252
Cerebellar Diseases	Stimulate	35012600
Cerebellar Diseases	Associate	35012600
Ceroid Lipofuscinosis Neuronal 7	Associate	23374165
Cockayne Syndrome	Associate	31970402
Cognition Disorders	Associate	32412666
Colorectal Neoplasms	Associate	20860603
Developmental Disabilities	Associate	35052391
Diabetic Nephropathies	Associate	24498249
Disease	Associate	23735787
DNA Virus Infections	Associate	25921135
Drug Related Side Effects and Adverse Reactions	Associate	38139294
Edema	Associate	37058032
Endodermal Sinus Tumor	Inhibit	31513277
Endometrial Neoplasms	Associate	35682908, 37081869
Ependymoma	Associate	28387652
Epstein Barr Virus Infections	Associate	39334908
Familial ependymoma	Associate	18701711
Frontotemporal Lobar Degeneration	Associate	38139294
Glioblastoma	Associate	26108672
Glioma	Associate	33692623
Glioma	Stimulate	36917178
Hearing Disorders	Associate	26121033
Hearing Loss	Associate	26121033
Hearing Loss Noise Induced	Associate	26121033
Hematologic Neoplasms	Associate	21917750
Hepatoblastoma	Associate	39766782
Hypoxia	Inhibit	36899956
Hypoxia	Associate	37843099
Infections	Associate	36740097
Inflammation	Associate	37058032
Insomnia Fatal Familial	Associate	27338255
Intellectual Disability	Associate	35052391
Kidney Diseases	Associate	37058032
Laryngeal Neoplasms	Associate	24587265
Leukemia	Associate	30464179
Leukemia Lymphocytic Chronic B Cell	Associate	17179226, 26556860
Leukemia Myeloid Acute	Associate	28103300
Lung Diseases	Associate	21998300, 36899956
Lung Neoplasms	Associate	28542563, 36640053, 40333559
Lupus Erythematosus Systemic	Associate	31292492
Lymphatic Metastasis	Associate	20860603, 26254615
Lymphoma Large B Cell Diffuse	Associate	28690315
Lymphoma Mantle Cell	Associate	24452204, 24677400
Melanoma	Associate	19363676
Mesothelioma Malignant	Associate	32671956
Microphthalmia Syndromic 10	Associate	32412666
Muscle Hypotonia	Associate	22727047
Muscular Diseases	Associate	28025995
Nasopharyngeal Carcinoma	Associate	39334908
Nasopharyngeal Neoplasms	Associate	32929347
Necrosis	Associate	37058032
Neoplasm Metastasis	Associate	20860603, 23382938, 35682908, 37058032
Neoplasms	Associate	12391018, 16698799, 18560571, 19404156, 20860603, 21859890, 21998300, 22703281, 23382938, 24242861, 24422969, 25230759, 25313645, 25326811, 26108672 View all (26 more)
Neoplasms	Stimulate	35562881
Neuroaxonal Dystrophies	Associate	23735787
Neuroblastoma	Associate	1657899, 36209521, 37947594
Neuronal Ceroid Lipofuscinoses	Associate	35012600
Ovarian Neoplasms	Associate	23471483
Pancreatic Neoplasms	Associate	37039106
Pancreatitis	Associate	37039106
Parkinson Disease	Inhibit	19409963
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	32011831
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30464179
Prehypertension	Associate	30464179
Prostatic Neoplasms	Associate	16869958, 30291252, 32851058
Prostatic Neoplasms	Stimulate	35562881
Pulmonary Disease Chronic Obstructive	Associate	28025995
Refractive Errors	Associate	25387707
Sarcoidosis	Inhibit	27575817
Sarcoma Kaposi	Associate	38140679
Seizures	Associate	32412666, 35012600
Seminoma	Stimulate	31513277
Squamous Cell Carcinoma of Head and Neck	Associate	31644306, 35550917, 36296374
T cell immunodeficiency primary	Associate	9626046
Testicular Neoplasms	Associate	31513277
Thyroid Cancer Papillary	Associate	23918302, 25326811
Triple Negative Breast Neoplasms	Stimulate	35313339
Triple Negative Breast Neoplasms	Associate	39294656, 40653460
Urinary Bladder Neoplasms	Associate	36293387, 37262080
Uterine Cervical Neoplasms	Associate	12391018, 16698799, 26254615, 35128835
Virus Diseases	Associate	35052391, 39766782

NCL (nucleolin)