Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4690
Gene name Gene Name - the full gene name approved by the HGNC.
NCK adaptor protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NCK1
Synonyms (NCBI Gene) Gene synonyms aliases
NCK, NCKalpha, nck-1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinas
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT643163 hsa-miR-548a-3p HITS-CLIP 23824327
MIRT643162 hsa-miR-548ar-3p HITS-CLIP 23824327
MIRT643161 hsa-miR-548az-3p HITS-CLIP 23824327
MIRT643160 hsa-miR-548e-3p HITS-CLIP 23824327
MIRT643159 hsa-miR-548f-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16835242
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000164 Component Protein phosphatase type 1 complex IDA 16835242
GO:0004860 Function Protein kinase inhibitor activity IDA 18835251
GO:0005102 Function Signaling receptor binding IPI 12110186
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600508 7664 ENSG00000158092
Protein
UniProt ID P16333
Protein name SH2/SH3 adapter protein NCK1 (Cytoplasmic protein NCK1) (NCK adapter protein 1) (Nck-1) (SH2/SH3 adapter protein NCK-alpha)
Protein function Adapter protein which associates with tyrosine-phosphorylated growth factor receptors, such as KDR and PDGFRB, or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role i
PDB 2CI8 , 2CI9 , 2CUB , 2JS0 , 2JS2 , 2JW4 , 5QU1 , 5QU2 , 5QU3 , 5QU4 , 5QU5 , 5QU6 , 5QU7 , 5QU8 , 5QUA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 8 53 SH3 domain Domain
PF14604 SH3_9 113 161 Variant SH3 domain Domain
PF00018 SH3_1 196 244 SH3 domain Domain
PF00017 SH2 282 356 SH2 domain Domain
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVT
EEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPK
NYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHY
KKAP
IFTSEQGEKLYLVKHLS
Sequence length 377
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ErbB signaling pathway
Axon guidance
T cell receptor signaling pathway
Pathogenic Escherichia coli infection
  Downstream signal transduction
Generation of second messenger molecules
Regulation of actin dynamics for phagocytic cup formation
Nephrin family interactions
DCC mediated attractive signaling
VEGFA-VEGFR2 Pathway
RHO GTPases Activate WASPs and WAVEs
FCGR3A-mediated phagocytosis
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 23940598
Breast Neoplasms Associate 23706161
Capsule Opacification Associate 35058548
Carcinogenesis Associate 36412985
Carcinoma Hepatocellular Associate 21397687
Carcinoma Hepatocellular Stimulate 35306563
Carcinoma Non Small Cell Lung Associate 33629305
Carcinoma Non Small Cell Lung Stimulate 33629937
Carcinoma Squamous Cell Stimulate 33629937
Esophageal Neoplasms Associate 35311444