Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4690
Gene name	NCK adaptor protein 1
Gene symbol	NCK1
Synonyms (NCBI Gene)	NCKNCKalphanck-1
Chromosome	3
Chromosome location	3q22.3
Summary	The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinas

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT643163	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT643162	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT643161	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT643160	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT643159	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT643158	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT643157	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT643156	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT643155	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT643163	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT643162	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT643161	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT643160	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT643159	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT643158	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT643157	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT643156	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT643155	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT1176361	hsa-miR-142-5p	CLIP-seq
MIRT1176362	hsa-miR-183	CLIP-seq
MIRT1176363	hsa-miR-190	CLIP-seq
MIRT1176364	hsa-miR-190b	CLIP-seq
MIRT1176365	hsa-miR-217	CLIP-seq
MIRT1176366	hsa-miR-3166	CLIP-seq
MIRT1176367	hsa-miR-3167	CLIP-seq
MIRT1176368	hsa-miR-338-5p	CLIP-seq
MIRT1176369	hsa-miR-340	CLIP-seq
MIRT1176370	hsa-miR-4659a-3p	CLIP-seq
MIRT1176371	hsa-miR-4659b-3p	CLIP-seq
MIRT1176372	hsa-miR-4699-3p	CLIP-seq
MIRT1176373	hsa-miR-4762-3p	CLIP-seq
MIRT1176374	hsa-miR-548an	CLIP-seq
MIRT1176375	hsa-miR-548c-3p	CLIP-seq
MIRT1176376	hsa-miR-586	CLIP-seq
MIRT1176377	hsa-miR-587	CLIP-seq
MIRT1176378	hsa-miR-876-5p	CLIP-seq
MIRT1176379	hsa-miR-890	CLIP-seq
MIRT2051057	hsa-miR-141	CLIP-seq
MIRT1176361	hsa-miR-142-5p	CLIP-seq
MIRT1176363	hsa-miR-190	CLIP-seq
MIRT1176364	hsa-miR-190b	CLIP-seq
MIRT2051058	hsa-miR-200a	CLIP-seq
MIRT2051059	hsa-miR-3136-5p	CLIP-seq
MIRT1176367	hsa-miR-3167	CLIP-seq
MIRT1176369	hsa-miR-340	CLIP-seq
MIRT2051060	hsa-miR-3607-5p	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2051063	hsa-miR-3924	CLIP-seq
MIRT2051064	hsa-miR-431	CLIP-seq
MIRT2051065	hsa-miR-4439	CLIP-seq
MIRT2051066	hsa-miR-4513	CLIP-seq
MIRT2051067	hsa-miR-4639-3p	CLIP-seq
MIRT1176370	hsa-miR-4659a-3p	CLIP-seq
MIRT1176371	hsa-miR-4659b-3p	CLIP-seq
MIRT2051068	hsa-miR-4711-3p	CLIP-seq
MIRT2051069	hsa-miR-4718	CLIP-seq
MIRT1176373	hsa-miR-4762-3p	CLIP-seq
MIRT2051070	hsa-miR-515-5p	CLIP-seq
MIRT1176376	hsa-miR-586	CLIP-seq
MIRT1176377	hsa-miR-587	CLIP-seq
MIRT2051071	hsa-miR-590-3p	CLIP-seq
MIRT1176378	hsa-miR-876-5p	CLIP-seq
MIRT2051057	hsa-miR-141	CLIP-seq
MIRT2051058	hsa-miR-200a	CLIP-seq
MIRT2280192	hsa-miR-4264	CLIP-seq
MIRT2280193	hsa-miR-4275	CLIP-seq
MIRT2280194	hsa-miR-4496	CLIP-seq
MIRT2280195	hsa-miR-4666-5p	CLIP-seq
MIRT2280196	hsa-miR-4672	CLIP-seq
MIRT2280197	hsa-miR-4797-3p	CLIP-seq
MIRT2280198	hsa-miR-622	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2280199	hsa-miR-4704-3p	CLIP-seq
MIRT2578690	hsa-miR-137	CLIP-seq
MIRT1176368	hsa-miR-338-5p	CLIP-seq
MIRT2578691	hsa-miR-3692	CLIP-seq
MIRT2578692	hsa-miR-369-3p	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2578693	hsa-miR-4263	CLIP-seq
MIRT2578694	hsa-miR-4436b-5p	CLIP-seq
MIRT2578695	hsa-miR-4504	CLIP-seq
MIRT1176372	hsa-miR-4699-3p	CLIP-seq
MIRT2578696	hsa-miR-4735-5p	CLIP-seq
MIRT2578697	hsa-miR-4775	CLIP-seq
MIRT2578698	hsa-miR-4795-3p	CLIP-seq
MIRT2578699	hsa-miR-542-3p	CLIP-seq
MIRT2578700	hsa-miR-576-5p	CLIP-seq
MIRT2051071	hsa-miR-590-3p	CLIP-seq
MIRT2578701	hsa-miR-619	CLIP-seq
MIRT2578702	hsa-miR-875-3p	CLIP-seq
MIRT1176379	hsa-miR-890	CLIP-seq
MIRT1176368	hsa-miR-338-5p	CLIP-seq
MIRT2578692	hsa-miR-369-3p	CLIP-seq
MIRT2051061	hsa-miR-374a	CLIP-seq
MIRT2051062	hsa-miR-374b	CLIP-seq
MIRT2578693	hsa-miR-4263	CLIP-seq
MIRT2578695	hsa-miR-4504	CLIP-seq
MIRT1176372	hsa-miR-4699-3p	CLIP-seq
MIRT2578696	hsa-miR-4735-5p	CLIP-seq
MIRT2578697	hsa-miR-4775	CLIP-seq
MIRT2578699	hsa-miR-542-3p	CLIP-seq
MIRT2578700	hsa-miR-576-5p	CLIP-seq
MIRT2051071	hsa-miR-590-3p	CLIP-seq
MIRT2578701	hsa-miR-619	CLIP-seq
MIRT2578702	hsa-miR-875-3p	CLIP-seq
MIRT1176379	hsa-miR-890	CLIP-seq

Show/Hide all (79)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16835242
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000164	Component	Protein phosphatase type 1 complex	IDA	16835242
GO:0004860	Function	Protein kinase inhibitor activity	IDA	18835251
GO:0005102	Function	Signaling receptor binding	IPI	12110186
GO:0005515	Function	Protein binding	IPI	9346925, 9697839, 10026169, 10206341, 10229072, 10521462, 11418237, 12620186, 15469942, 15929943, 16273093, 16374509, 16525419, 16595635, 16636290, 16777958, 16966330, 17474147, 17617578, 18320063, 18835251, 18955169, 20562827, 21664272, 21725281, 21988832, 22074159, 24658140, 24728
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	38614099
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	12110186
GO:0005737	Component	Cytoplasm	TAS	2107526
GO:0005783	Component	Endoplasmic reticulum	IDA	16835242
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IDA	11959995
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006930	Process	Substrate-dependent cell migration, cell extension	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007172	Process	Signal complex assembly	NAS	12110186
GO:0008093	Function	Cytoskeletal anchor activity	NAS	12110186
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0012506	Component	Vesicle membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	NAS	12110186
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	21707536
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	12110186
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	23358419
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	16835242
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0035591	Function	Signaling adaptor activity	IDA	16835242
GO:0036491	Process	Regulation of translation initiation in response to endoplasmic reticulum stress	IDA	14676213
GO:0036491	Process	Regulation of translation initiation in response to endoplasmic reticulum stress	IEA
GO:0036493	Process	Positive regulation of translation in response to endoplasmic reticulum stress	IBA
GO:0036493	Process	Positive regulation of translation in response to endoplasmic reticulum stress	IDA	14676213
GO:0036493	Process	Positive regulation of translation in response to endoplasmic reticulum stress	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	12110186
GO:0042110	Process	T cell activation	IMP	12110186
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	11368773
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10026169
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IMP	21707536
GO:0046875	Function	Ephrin receptor binding	IBA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	11368773, 38614099
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	38614099
GO:0051707	Process	Response to other organism	IEA
GO:0071074	Function	Eukaryotic initiation factor eIF2 binding	IEA
GO:0071074	Function	Eukaryotic initiation factor eIF2 binding	IPI	11959995
GO:0140311	Function	Protein sequestering activity	IDA	38614099
GO:0140374	Process	Antiviral innate immune response	IDA	18835251
GO:0140693	Function	Molecular condensate scaffold activity	IDA	26553976
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IBA
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	14676213
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1903676	Process	Positive regulation of cap-dependent translational initiation	IDA	11959995
GO:1903679	Process	Positive regulation of cap-independent translational initiation	IDA	11959995
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IBA
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IDA	14676213
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IEA

MIM	HGNC	e!Ensembl
600508	7664	ENSG00000158092

P16333

Protein name

SH2/SH3 adapter protein NCK1 (Cytoplasmic protein NCK1) (NCK adapter protein 1) (Nck-1) (SH2/SH3 adapter protein NCK-alpha)

Protein function

Adapter protein which associates with tyrosine-phosphorylated growth factor receptors, such as KDR and PDGFRB, or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role i

PDB

2CI8 , 2CI9 , 2CUB , 2JS0 , 2JS2 , 2JW4 , 5QU1 , 5QU2 , 5QU3 , 5QU4 , 5QU5 , 5QU6 , 5QU7 , 5QU8 , 5QUA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	8 → 53	SH3 domain	Domain
PF14604	SH3_9	113 → 161	Variant SH3 domain	Domain
PF00018	SH3_1	196 → 244	SH3 domain	Domain
PF00017	SH2	282 → 356	SH2 domain	Domain

Sequence

MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS

Sequence length

377

Interactions

View interactions

	KEGG		Reactome
	ErbB signaling pathway Axon guidance T cell receptor signaling pathway Pathogenic Escherichia coli infection		Downstream signal transduction Generation of second messenger molecules Regulation of actin dynamics for phagocytic cup formation Nephrin family interactions DCC mediated attractive signaling VEGFA-VEGFR2 Pathway RHO GTPases Activate WASPs and WAVEs FCGR3A-mediated phagocytosis Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

NCK1 (NCK adaptor protein 1)