Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	468
Gene name	Activating transcription factor 4
Gene symbol	ATF4
Synonyms (NCBI Gene)	CREB-2CREB2TAXREB67TXREB
Chromosome	22
Chromosome location	22q13.1
Summary	This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as

Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007201	hsa-miR-214-3p	Luciferase reporter assay	23223004
MIRT007201	hsa-miR-214-3p	Luciferase reporter assay	23223004
MIRT043684	hsa-miR-342-3p	CLASH	23622248
MIRT042655	hsa-miR-196b-5p	CLASH	23622248
MIRT735196	hsa-miR-124-3p	Western blottingImmunohistochemistry (IHC)in vitro cullelar assaysqRT-PCRImmunocytochemistry (ICC)	33161580
MIRT804281	hsa-miR-3120-3p	CLIP-seq
MIRT804282	hsa-miR-548v	CLIP-seq
MIRT804281	hsa-miR-3120-3p	CLIP-seq
MIRT804282	hsa-miR-548v	CLIP-seq
MIRT804281	hsa-miR-3120-3p	CLIP-seq
MIRT804282	hsa-miR-548v	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HDAC4	Unknown	24308964
IRF7	Activation	21148039
TRIB3	Repression	15781252;17707795

161

Show/Hide all (161)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	12871976
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	21113145
GO:0000976	Function	Transcription cis-regulatory region binding	TAS	23392669
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	11478948, 12871976
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IDA	15788408, 15911876, 18940792
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11960987, 15109498, 23123191, 31023583, 32132707
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	12689582
GO:0005515	Function	Protein binding	IPI	9488481, 11238952, 12743605, 12812986, 12860379, 15677469, 16169070, 16189514, 16343488, 16682973, 18330356, 18940792, 19164757, 19447967, 20102225, 20211142, 20936779, 21408167, 21988832, 23123191, 23661758, 25241761, 25416956, 25910212, 26700459, 26871637, 28514442, 29892012, 3141
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11478948, 16682973, 23123191, 23392669
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	NAS	12871976, 20102225, 23661758, 28186491
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	23392669
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	20873783
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISO
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758, 28186491
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	ISS
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0007214	Process	Gamma-aminobutyric acid signaling pathway	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008140	Function	CAMP response element binding protein binding	IEA
GO:0008140	Function	CAMP response element binding protein binding	ISS
GO:0009636	Process	Response to toxic substance	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	22915762
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	16445384
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0019901	Function	Protein kinase binding	IPI	20873783
GO:0030182	Process	Neuron differentiation	IEA
GO:0030282	Process	Bone mineralization	IEA
GO:0030282	Process	Bone mineralization	ISS
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	ISS
GO:0031667	Process	Response to nutrient levels	IDA	11960987
GO:0032057	Process	Negative regulation of translational initiation in response to stress	ISS
GO:0032590	Component	Dendrite membrane	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IDA	20873783
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	ISS
GO:0034399	Component	Nuclear periphery	IDA	23392669
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	IMP	21113145, 23392669
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0034644	Process	Cellular response to UV	ISS
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	12871976, 19061639, 33384352
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	21113145, 24939851
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0036499	Process	PERK-mediated unfolded protein response	IDA	31023583
GO:0036499	Process	PERK-mediated unfolded protein response	IEA
GO:0036499	Process	PERK-mediated unfolded protein response	ISS
GO:0036499	Process	PERK-mediated unfolded protein response	TAS	22013210, 22934019
GO:0042149	Process	Cellular response to glucose starvation	IMP	22915762
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISS
GO:0042802	Function	Identical protein binding	IPI	16343488, 23661758
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043005	Component	Neuron projection	IDA	23392669
GO:0043065	Process	Positive regulation of apoptotic process	TAS	23392669
GO:0043267	Process	Negative regulation of potassium ion transport	IEA
GO:0043522	Function	Leucine zipper domain binding	IDA	11478948
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	22915762
GO:0045667	Process	Regulation of osteoblast differentiation	IDA	15109498
GO:0045667	Process	Regulation of osteoblast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15775988, 18940792
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	11960987
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9190894
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	IMP	22915762
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11478948, 11960987, 12871976, 15109498, 15775988, 16343488, 18940792, 23123191
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	15788408, 21113145, 24939851
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISO
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	23392669
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	14685163
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	11478948
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS
GO:0070169	Process	Positive regulation of biomineral tissue development	IEA
GO:0070309	Process	Lens fiber cell morphogenesis	IEA
GO:0070309	Process	Lens fiber cell morphogenesis	ISS
GO:0070982	Process	L-asparagine metabolic process	IDA	11960987
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISO
GO:0097250	Process	Mitochondrial respirasome assembly	IDA	27545886, 31023583
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	22980225
GO:0140296	Function	General transcription initiation factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140467	Process	Integrated stress response signaling	IDA	32132707
GO:0140467	Process	Integrated stress response signaling	IEA
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:0140468	Process	HRI-mediated signaling	IDA	32132706, 32132707
GO:0160144	Process	GDF15-GFRAL signaling pathway	IDA	31535977
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IGI	23392669
GO:1905461	Process	Positive regulation of vascular associated smooth muscle cell apoptotic process	IEA
GO:1990037	Component	Lewy body core	IDA	23392669
GO:1990253	Process	Cellular response to leucine starvation	IDA	17267404
GO:1990253	Process	Cellular response to leucine starvation	IEA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IBA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IDA	12871976
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IEA
GO:1990590	Component	ATF1-ATF4 transcription factor complex	IBA
GO:1990590	Component	ATF1-ATF4 transcription factor complex	IDA	12871976
GO:1990590	Component	ATF1-ATF4 transcription factor complex	IEA
GO:1990617	Component	CHOP-ATF4 complex	IDA	11478948
GO:1990617	Component	CHOP-ATF4 complex	IPI	18940792
GO:1990617	Component	CHOP-ATF4 complex	NAS	15775988
GO:1990737	Process	Response to manganese-induced endoplasmic reticulum stress	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	17267404
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000120	Process	Positive regulation of sodium-dependent phosphate transport	IEA

MIM	HGNC	e!Ensembl
604064	786	ENSG00000128272

P18848

Protein name

Cyclic AMP-dependent transcription factor ATF-4 (cAMP-dependent transcription factor ATF-4) (Activating transcription factor 4) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (Tax-responsive enhancer

Protein function

Transcription factor that binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3') and displays two biological functions, as regulator of metabolic and redox processes under normal cellular conditions, and as master transcription

PDB

1CI6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	276 → 339	bZIP transcription factor	Coiled-coil

Sequence

MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Sequence length

351

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway cGMP-PKG signaling pathway Mitophagy - animal Protein processing in endoplasmic reticulum PI3K-Akt signaling pathway Apoptosis Longevity regulating pathway Adrenergic signaling in cardiomyocytes TNF signaling pathway Long-term potentiation Neurotrophin signaling pathway Cholinergic synapse Dopaminergic synapse Insulin secretion GnRH signaling pathway Estrogen signaling pathway Thyroid hormone synthesis Glucagon signaling pathway Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Non-alcoholic fatty liver disease Cushing syndrome Growth hormone synthesis, secretion and action Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Cocaine addiction Amphetamine addiction Alcoholism Hepatitis B Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Viral carcinogenesis Chemical carcinogenesis - receptor activation Prostate cancer Lipid and atherosclerosis		ATF4 activates genes in response to endoplasmic reticulum stress ATF6 (ATF6-alpha) activates chaperone genes Response of EIF2AK4 (GCN2) to amino acid deficiency Response of EIF2AK1 (HRI) to heme deficiency

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL, BREAST	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (124)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acidosis	Stimulate	28134810	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute On Chronic Liver Failure	Associate	26173605	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	29676829, 31551255, 36226539	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	26066753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	39965324	★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha 1 Antitrypsin Deficiency Autosomal Recessive	Associate	33749723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	36867706	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amino Acid Metabolism Inborn Errors	Associate	22135092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	25811130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Axial osteomalacia	Associate	34698138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	28553953	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	23294542, 23975372, 27109102, 35662627	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	31064130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	33586907	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	36416348	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Associate	35906698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	23973991, 24330582, 26917416, 29921924, 31523192, 34072570, 34664408, 35389768, 35615577, 36925047, 37457742, 37906604	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	23975372, 28534368, 33628101, 35864117, 36051358	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Stimulate	35962830	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	34839022	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	33782384, 38553134	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Stimulate	36416348	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	35728000	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	36012132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Associate	26091066	★★★★★ ★☆☆☆☆ Found in Text Mining only
CD59 Deficiency	Associate	35703068	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	24587347	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	29420561, 36246978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	22435535, 22819556, 27468213, 29453334, 32323831, 32888357, 34663797, 35524408, 35883579, 36879117	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	30382797	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	32323565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	26986695	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	23624551	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Associate	30246236	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	20022965, 31524237	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Stimulate	28991167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy rolandic with paroxysmal exercise induced dystonia and writer's cramp	Associate	40646440	★★★★★ ★☆☆☆☆ Found in Text Mining only
Escherichia coli Infections	Associate	26986695	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	32398095	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocartilaginous embolism	Associate	36324122	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	29698579, 29991528, 31534165, 33111629, 34239013, 36245009, 37823569, 39652629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	28553953, 29716673	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Associate	28553953	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	34306318	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Stimulate	33170831	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Stimulate	28438094	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Associate	32755585	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Associate	34347195	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	27400471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	14604972, 28438094, 37823569	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Associate	19018773, 23294542, 29749460, 31424999, 34239013, 36416348	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia Brain	Stimulate	14604972	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	18635891, 36555349, 37978501	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Stimulate	39745695	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	32369565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	26040555, 36012132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	30382797	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Associate	30029277	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	26275811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	27802179	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	34507566, 35305370	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathies	Associate	31691183	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Associate	37205634	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	36555349	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	30305853, 33628101, 36521248, 36864513	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	23975372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	35019856	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	35019856	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Effusion	Associate	31366879	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development Group I	Associate	36431966	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesenchymal tumor	Associate	37192160	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Associate	36324122	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	25016296, 28380427, 30209241, 33554439, 33586907	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	37906604	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Associate	29921948	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Complex III Deficiency	Associate	25375376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	26771712, 27708226, 33837631, 34285383, 34306318	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Stimulate	29698579	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Associate	40037075	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	26636288, 30824741, 32070879, 34378191	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Stimulate	32640422	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	37906604	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Stimulate	26091066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Associate	26351848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Associate	25978849	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	31064130, 35615577, 35883579	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	14604972, 22135092, 22915762, 23916134, 24330582, 26565589, 27651314, 28438094, 28553953, 29062139, 29257326, 29716673, 30209241, 30305853, 31211507 View all (9 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	23975372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	30552230	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Associate	28553953	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	20667453	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Associate	20022965	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	30382797, 36170814	★★★★★ ★☆☆☆☆ Found in Text Mining only
Odontogenic Cysts	Stimulate	31424999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Stimulate	26091066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	37285835	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	35484984	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	33782384, 36416348	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Associate	32571297	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	30382797	★★★★★ ★☆☆☆☆ Found in Text Mining only
Postthrombotic Syndrome	Associate	27400471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	26275811, 33741715	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	37280363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pregnancy Complications	Associate	26648175	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	23448667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychological Distress	Associate	27651314	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Stimulate	23400395	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	23471465, 38320732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Associate	36555349	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Associate	33741715	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Associate	36377873	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Inhibit	38320732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Stimulate	23400395	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Stimulate	24964091	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	22363646, 27708226, 29587440, 30380689, 37192160	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Associate	33277874	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Associate	25795775, 30552230	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	22691366	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	37834012	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	25002527	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stimulate	30426803	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	36431966	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Ulcer	Associate	27400471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Stimulate	36243930	★★★★★ ★☆☆☆☆ Found in Text Mining only

ATF4 (activating transcription factor 4)