Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	467
Gene name	Activating transcription factor 3
Gene symbol	ATF3
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q32.3
Summary	This gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells,

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029081	hsa-miR-26b-5p	Microarray	19088304
MIRT050819	hsa-miR-17-5p	CLASH	23622248
MIRT043494	hsa-miR-331-3p	CLASH	23622248
MIRT053227	hsa-miR-494-3p	qRT-PCRWestern blot	23160513
MIRT438586	hsa-miR-30a-3p	ImmunohistochemistryMicroarrayqRT-PCR	23787480
MIRT438585	hsa-miR-30e-3p	ImmunohistochemistryMicroarrayqRT-PCR	23787480
MIRT438584	hsa-miR-505-5p	ImmunohistochemistryMicroarrayqRT-PCR	23787480
MIRT438586	hsa-miR-30a-3p	ImmunohistochemistryMicroarrayqRT-PCR	23787480
MIRT438585	hsa-miR-30e-3p	ImmunohistochemistryMicroarrayqRT-PCR	23787480
MIRT438584	hsa-miR-505-5p	ImmunohistochemistryMicroarrayqRT-PCR	23787480
MIRT528884	hsa-miR-1179	PAR-CLIP	22012620
MIRT528883	hsa-miR-3614-3p	PAR-CLIP	22012620
MIRT528882	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT528881	hsa-miR-216b-3p	PAR-CLIP	22012620
MIRT528880	hsa-miR-4310	PAR-CLIP	22012620
MIRT528879	hsa-miR-7157-5p	PAR-CLIP	22012620
MIRT528878	hsa-miR-584-3p	PAR-CLIP	22012620
MIRT528876	hsa-miR-4277	PAR-CLIP	22012620
MIRT528877	hsa-miR-4267	PAR-CLIP	22012620
MIRT528875	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT528874	hsa-miR-4291	PAR-CLIP	22012620
MIRT528873	hsa-miR-6512-3p	PAR-CLIP	22012620
MIRT528872	hsa-miR-6720-5p	PAR-CLIP	22012620
MIRT528871	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT528870	hsa-miR-24-3p	PAR-CLIP	22012620
MIRT053227	hsa-miR-494-3p	ELISALuciferase reporter assayqRT-PCRWestern blotting	31930399
MIRT733922	hsa-miR-27a-3p	Immunohistochemistry (IHC)Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	33230462
MIRT736839	hsa-miR-145-3p	RNA-seqqRT-PCR	33652981
MIRT736840	hsa-miR-143-3p	RNA-seqqRT-PCR	33652981
MIRT528884	hsa-miR-1179	PAR-CLIP	22012620
MIRT528883	hsa-miR-3614-3p	PAR-CLIP	22012620
MIRT528882	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT528881	hsa-miR-216b-3p	PAR-CLIP	22012620
MIRT528880	hsa-miR-4310	PAR-CLIP	22012620
MIRT528879	hsa-miR-7157-5p	PAR-CLIP	22012620
MIRT528878	hsa-miR-584-3p	PAR-CLIP	22012620
MIRT528876	hsa-miR-4277	PAR-CLIP	22012620
MIRT528877	hsa-miR-4267	PAR-CLIP	22012620
MIRT528875	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT528874	hsa-miR-4291	PAR-CLIP	22012620
MIRT528873	hsa-miR-6512-3p	PAR-CLIP	22012620
MIRT528872	hsa-miR-6720-5p	PAR-CLIP	22012620
MIRT528871	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT528870	hsa-miR-24-3p	PAR-CLIP	22012620
MIRT804260	hsa-miR-29a	CLIP-seq
MIRT804261	hsa-miR-29b	CLIP-seq
MIRT804262	hsa-miR-29c	CLIP-seq
MIRT804263	hsa-miR-3119	CLIP-seq
MIRT804264	hsa-miR-3174	CLIP-seq
MIRT804265	hsa-miR-3620	CLIP-seq
MIRT804266	hsa-miR-3663-3p	CLIP-seq
MIRT804267	hsa-miR-376a	CLIP-seq
MIRT804268	hsa-miR-376b	CLIP-seq
MIRT804269	hsa-miR-4484	CLIP-seq
MIRT804270	hsa-miR-4663	CLIP-seq
MIRT804271	hsa-miR-548an	CLIP-seq
MIRT804272	hsa-miR-921	CLIP-seq
MIRT804273	hsa-miR-3064-3p	CLIP-seq
MIRT804274	hsa-miR-4299	CLIP-seq
MIRT804275	hsa-miR-450b-5p	CLIP-seq
MIRT804276	hsa-miR-4682	CLIP-seq
MIRT804277	hsa-miR-4751	CLIP-seq
MIRT804278	hsa-miR-492	CLIP-seq
MIRT804279	hsa-miR-1252	CLIP-seq
MIRT804280	hsa-miR-4428	CLIP-seq
MIRT2444161	hsa-miR-2355-5p	CLIP-seq
MIRT2480448	hsa-miR-1224-3p	CLIP-seq
MIRT2480449	hsa-miR-1260	CLIP-seq
MIRT2480450	hsa-miR-1260b	CLIP-seq
MIRT2480451	hsa-miR-1280	CLIP-seq
MIRT804279	hsa-miR-1252	CLIP-seq
MIRT2675554	hsa-miR-1273f	CLIP-seq
MIRT2675555	hsa-miR-1299	CLIP-seq
MIRT2675556	hsa-miR-1470	CLIP-seq
MIRT2675557	hsa-miR-3135	CLIP-seq
MIRT2675558	hsa-miR-3189-5p	CLIP-seq
MIRT2675559	hsa-miR-378	CLIP-seq
MIRT2675560	hsa-miR-378b	CLIP-seq
MIRT2675561	hsa-miR-378c	CLIP-seq
MIRT2675562	hsa-miR-378d	CLIP-seq
MIRT2675563	hsa-miR-378e	CLIP-seq
MIRT2675564	hsa-miR-378f	CLIP-seq
MIRT2675565	hsa-miR-378h	CLIP-seq
MIRT2675566	hsa-miR-378i	CLIP-seq
MIRT2675567	hsa-miR-422a	CLIP-seq
MIRT2675568	hsa-miR-4317	CLIP-seq
MIRT804280	hsa-miR-4428	CLIP-seq
MIRT2675569	hsa-miR-4638-3p	CLIP-seq
MIRT2675570	hsa-miR-4667-3p	CLIP-seq
MIRT2675571	hsa-miR-4774-3p	CLIP-seq
MIRT2675572	hsa-miR-4782-5p	CLIP-seq
MIRT2675573	hsa-miR-516b	CLIP-seq
MIRT2675574	hsa-miR-578	CLIP-seq
MIRT2675575	hsa-miR-642b	CLIP-seq

Show/Hide all (14)

Transcription factor	Regulation	Reference
ATF2	Activation	10979959;20581861;8576171
ATF4	Activation	16246168;21801305
ATF4	Unknown	22819556
EGR1	Activation	21205742
EGR1	Unknown	16489044
JDP2	Repression	22989952
JDP2	Unknown	19233874
JUN	Activation	8576171
KLF4	Activation	21205742
KLF6	Activation	18755691
MEF2D	Activation	17108111
MYC	Unknown	21384303
NFKB1	Unknown	24100018
TP53	Activation	12372430

Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7515060, 8622660
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	14685163
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	24939851
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	2516827, 8622660
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	18308734
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	8622660
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	18308734
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IGI	24939851
GO:0005515	Function	Protein binding	IPI	10327051, 16291753, 18255255, 19164757, 20102225, 20211142, 23661758, 25609649, 27107012, 28514442, 29997244, 30833792, 31467278, 32814053, 32911434, 33961781, 35271311, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	7515060, 8622660
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8622660, 20102225, 23661758, 28186491
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IDA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	8622660
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758, 28186491
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	24939851
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0042802	Function	Identical protein binding	IPI	18255255, 23661758
GO:0042803	Function	Protein homodimerization activity	IPI	8622660
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731, 24939851
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	18308734
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	1406655
GO:0046982	Function	Protein heterodimerization activity	IPI	8622660
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:1903984	Process	Positive regulation of TRAIL-activated apoptotic signaling pathway	IMP	24939851
GO:1990622	Component	CHOP-ATF3 complex	IDA	8622660
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
603148	785	ENSG00000162772

P18847

Protein name

Cyclic AMP-dependent transcription factor ATF-3 (cAMP-dependent transcription factor ATF-3) (Activating transcription factor 3)

Protein function

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing th

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	84 → 145	bZIP transcription factor	Coiled-coil

Sequence

MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S

Sequence length

181

Interactions

View interactions

	Reactome
			Response of EIF2AK1 (HRI) to heme deficiency

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
ATF3-related disorder	Benign; Likely benign	rs45627140, rs148364357	RCV003919516 RCV003932107

Show/Hide Text Mining Associations (115)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acidosis	Stimulate	28134810
ACTH Secreting Pituitary Adenoma	Associate	25400120
Adrenocortical Carcinoma	Associate	25400120, 39965324
Alzheimer Disease	Associate	31377428
Asthma	Associate	30669148
Atherosclerosis	Associate	12161427, 27146783
Atherosclerosis	Stimulate	34320932
Bipolar Disorder	Associate	20633309
Bone Diseases	Associate	25380580
Brain Injuries	Associate	31356870
Brain Ischemia	Associate	18692824
Breast Neoplasms	Associate	20930144, 21429729, 25380580, 25486199, 26537518, 29534690, 32988253, 33885357, 34213887, 36010586, 36318106
Carcinogenesis	Associate	20002170, 20167600, 33407456, 35871061
Carcinoma Hepatocellular	Associate	16109718, 16989641, 26917416, 30535500, 33407456, 37877357
Carcinoma Hepatocellular	Inhibit	31988297
Carcinoma Non Small Cell Lung	Associate	21801305
Carcinoma Non Small Cell Lung	Stimulate	37638687
Carcinoma Ovarian Epithelial	Associate	34320033
Carcinoma Renal Cell	Inhibit	38248871
Carcinoma Squamous Cell	Associate	24509533, 25371069
Cardiomyopathies	Associate	12488458
Cell Transformation Neoplastic	Stimulate	36131935
Cerebral Infarction	Associate	28834871, 35856366, 40399867
Cholangiocarcinoma	Associate	30648816
Cockayne Syndrome	Associate	23733932, 29225035, 31980658
Colitis Ulcerative	Associate	35185383
Colitis Ulcerative	Stimulate	35275975
Colorectal Neoplasms	Associate	17964072, 20110283, 20581861, 21205742, 21554132, 22230687, 22819556, 24939851, 25338635, 25494848, 27043582, 37833290
Colorectal Neoplasms	Stimulate	28402947
Colorectal Neoplasms	Inhibit	29966001
Common Variable Immunodeficiency	Associate	31263122
Coronary Artery Disease	Associate	34320932, 34552562
COVID 19	Associate	36380355
Crohn Disease	Associate	31557250
Cryptorchidism	Associate	22580635
Diabetes Mellitus	Associate	22046379, 32820009, 37713834
Diabetic Nephropathies	Inhibit	35721731
Disease	Associate	28059114
Drug Related Side Effects and Adverse Reactions	Associate	18836721, 30443171, 34448104
Dyslipidemias	Inhibit	26083362
Endometriosis	Associate	36232817
Epilepsy	Associate	23706953
Epstein Barr Virus Infections	Associate	32119176
Erythema Multiforme	Stimulate	20002170
Esophageal Neoplasms	Associate	32398095
Esophageal Squamous Cell Carcinoma	Associate	11092977, 34814273
Fibrosis	Associate	37059745
Glioblastoma	Associate	25872784, 39652629
Glioma	Stimulate	25872784
Glomerulonephritis IGA	Associate	28713898, 38278877
Hereditary leiomyomatosis and renal cell cancer	Associate	16263788
Hodgkin Disease	Associate	16263788
Hyperaldosteronism	Associate	25400120, 39252231
Hypertension	Associate	27400471
Hypertensive Nephropathy	Associate	28713898
Hypospadias	Associate	22580635, 23088992, 24469490, 27146783
Hypoxia	Stimulate	18755691
Hypoxia	Associate	34814273
Idiopathic Pulmonary Fibrosis	Associate	31952466
Immune System Diseases	Associate	39252231
Infections	Associate	27146783
Infections	Inhibit	40215645
Inflammation	Associate	12161427, 21744278, 23706953, 26083362, 29413899, 30440036, 31356870, 34320932, 35563134, 35585981, 36010586, 36787231, 37638687, 37962278, 40605044
Inflammation	Stimulate	22046379
Inflammation	Inhibit	28059114
Inflammatory Bowel Diseases	Associate	35275975
Leiomyoma	Associate	18692824
Leukemia	Associate	26275811
Leukemia Lymphoma Adult T Cell	Stimulate	21414204
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20571063
Lung Injury	Associate	33413422, 33921748
Lung Neoplasms	Inhibit	24554706
Lung Neoplasms	Associate	28239957
Lymphatic Metastasis	Inhibit	24554706
Lymphatic Metastasis	Stimulate	28239957
Lymphoma Large B Cell Diffuse	Associate	26747248, 27056992
Mesothelioma Malignant	Associate	20137089
Mohr Tranebjaerg syndrome	Inhibit	34098867
Multiple Myeloma	Associate	26636288
Neointima	Inhibit	26133317
Neoplasm Metastasis	Associate	11792711, 24554706, 33885357, 39994644
Neoplasms	Inhibit	19060337, 20581861, 29382334, 30535500, 37947652, 39994644, 40188876
Neoplasms	Associate	20167600, 20930144, 21554132, 22046379, 23591848, 24460316, 24554706, 25338635, 25400120, 25486199, 25494848, 25521189, 25872784, 26961878, 27146783 View all (15 more)
Neoplasms	Stimulate	28239957, 36177918
Neuralgia	Associate	29672183
Neuroma	Associate	39362479
Non alcoholic Fatty Liver Disease	Associate	33603714
Osteoarthritis	Associate	23884832, 38401067
Osteoarthritis	Stimulate	30186872
Osteoarthritis Knee	Associate	39341952
Osteoporosis	Associate	31389577
Ovarian Neoplasms	Associate	26418018, 35283423, 36177918
Pancreatitis	Associate	36671463
Papillomavirus Infections	Associate	20167600
Pelvic Organ Prolapse	Associate	19056808
Pre Eclampsia	Associate	24944161
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	26275811
Prostatic Neoplasms	Associate	18755691, 22046379, 23591848, 37686146
Pterygium	Associate	36187094
Renal Insufficiency	Associate	28577574
Renal Insufficiency Chronic	Associate	31257514
Schizophrenia	Associate	20633309
Seizures	Associate	23706953
Skin Neoplasms	Stimulate	24460316
Skin Neoplasms	Associate	25371069
Sleep Apnea Obstructive	Associate	39252231
Spinal Cord Injuries	Associate	26497545
Squamous Cell Carcinoma of Head and Neck	Associate	29946339, 31841185
Stomach Neoplasms	Associate	24260584, 32119176, 34098867
Stroke	Associate	40399867
Urinary Bladder Neoplasms	Associate	40188876, 40215645
Uterine Cervical Neoplasms	Inhibit	20167600, 39994644
Uveal melanoma	Stimulate	17003493
Varicose Ulcer	Associate	20069132, 27400471
Vascular Diseases	Associate	28059114

ATF3 (activating transcription factor 3)