Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4665
Gene name Gene Name - the full gene name approved by the HGNC.
NGFI-A binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NAB2
Synonyms (NCBI Gene) Gene synonyms aliases
MADER
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multim
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018637 hsa-miR-335-5p Microarray 18185580
MIRT1172507 hsa-miR-1207-5p CLIP-seq
MIRT1172508 hsa-miR-1275 CLIP-seq
MIRT1172509 hsa-miR-1280 CLIP-seq
MIRT1172510 hsa-miR-188-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
EGR1 Activation 16260776;20506119
EGR3 Activation 20506119
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001958 Process Endochondral ossification IEA
GO:0003712 Function Transcription coregulator activity IBA 21873635
GO:0003714 Function Transcription corepressor activity TAS 8668170
GO:0005515 Function Protein binding IPI 21516116, 25416956, 29892012, 31515488, 32296183
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602381 7627 ENSG00000166886
Protein
UniProt ID Q15742
Protein name NGFI-A-binding protein 2 (EGR-1-binding protein 2) (Melanoma-associated delayed early response protein) (Protein MADER)
Protein function Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04904 NCD1 36 114 NAB conserved region 1 (NCD1) Domain
PF04905 NCD2 236 364 NAB conserved region 2 (NCD2) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed at low levels. Highly expressed in melanoma cell lines.
Sequence
MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYET
FIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFS
QPVPAV
PVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAG
DPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPE
MVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI
IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSL
KGSR
LHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSP
CVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ
Sequence length 525
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    NGF-stimulated transcription
EGR2 and SOX10-mediated initiation of Schwann cell myelination
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Hypophosphatemic rickets Hypophosphatemic Rickets rs104894347, rs28937882, rs587776696, rs587776697, rs587776698, rs121908248, rs587776797, rs121908249, rs193922701, rs193922702, rs886041227, rs886041363, rs886041296, rs886041369, rs866429868
View all (6 more)
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
26198764
Unknown
Disease term Disease name Evidence References Source
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adamantinoma Associate 35303277
Bipolar Disorder Stimulate 20633309
Breast Neoplasms Associate 22431919, 25104439
Burkitt Lymphoma Associate 15241441
Carcinoma Large Cell Associate 33563892
Carcinoma Neuroendocrine Associate 33563892
Cardiomyopathy Dilated Stimulate 20392463
Disease Associate 34502329
Epstein Barr Virus Infections Associate 15241441
Gallbladder Neoplasms Associate 33563892