Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4665
Gene name Gene Name - the full gene name approved by the HGNC.	NGFI-A binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NAB2
Synonyms (NCBI Gene) Gene synonyms aliases	MADER
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multim

Show/Hide all(118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018637	hsa-miR-335-5p	Microarray	18185580
MIRT1172507	hsa-miR-1207-5p	CLIP-seq
MIRT1172508	hsa-miR-1275	CLIP-seq
MIRT1172509	hsa-miR-1280	CLIP-seq
MIRT1172510	hsa-miR-188-3p	CLIP-seq
MIRT1172511	hsa-miR-3179	CLIP-seq
MIRT1172512	hsa-miR-3668	CLIP-seq
MIRT1172513	hsa-miR-4436b-3p	CLIP-seq
MIRT1172514	hsa-miR-4640-5p	CLIP-seq
MIRT1172515	hsa-miR-4650-5p	CLIP-seq
MIRT1172516	hsa-miR-4665-5p	CLIP-seq
MIRT1172517	hsa-miR-4713-3p	CLIP-seq
MIRT1172518	hsa-miR-4726-5p	CLIP-seq
MIRT1172519	hsa-miR-4740-3p	CLIP-seq
MIRT1172520	hsa-miR-4761-3p	CLIP-seq
MIRT1172521	hsa-miR-4763-3p	CLIP-seq
MIRT1172522	hsa-miR-495	CLIP-seq
MIRT1172523	hsa-miR-518a-5p	CLIP-seq
MIRT1172524	hsa-miR-527	CLIP-seq
MIRT2049852	hsa-miR-134	CLIP-seq
MIRT2049853	hsa-miR-1915	CLIP-seq
MIRT2049854	hsa-miR-2467-3p	CLIP-seq
MIRT2049855	hsa-miR-28-3p	CLIP-seq
MIRT2049856	hsa-miR-296-3p	CLIP-seq
MIRT2049857	hsa-miR-3064-3p	CLIP-seq
MIRT2049858	hsa-miR-3118	CLIP-seq
MIRT2049859	hsa-miR-3125	CLIP-seq
MIRT2049860	hsa-miR-3164	CLIP-seq
MIRT2049861	hsa-miR-3916	CLIP-seq
MIRT2049862	hsa-miR-409-3p	CLIP-seq
MIRT2049863	hsa-miR-4252	CLIP-seq
MIRT2049864	hsa-miR-4423-5p	CLIP-seq
MIRT1172513	hsa-miR-4436b-3p	CLIP-seq
MIRT2049865	hsa-miR-4476	CLIP-seq
MIRT2049866	hsa-miR-4535	CLIP-seq
MIRT2049867	hsa-miR-4661-3p	CLIP-seq
MIRT2049868	hsa-miR-4685-5p	CLIP-seq
MIRT2049869	hsa-miR-4715-3p	CLIP-seq
MIRT2049870	hsa-miR-492	CLIP-seq
MIRT2049871	hsa-miR-758	CLIP-seq
MIRT2049872	hsa-miR-767-3p	CLIP-seq
MIRT2049852	hsa-miR-134	CLIP-seq
MIRT2049854	hsa-miR-2467-3p	CLIP-seq
MIRT2049856	hsa-miR-296-3p	CLIP-seq
MIRT2049858	hsa-miR-3118	CLIP-seq
MIRT2049859	hsa-miR-3125	CLIP-seq
MIRT2049860	hsa-miR-3164	CLIP-seq
MIRT2049861	hsa-miR-3916	CLIP-seq
MIRT2049865	hsa-miR-4476	CLIP-seq
MIRT2049867	hsa-miR-4661-3p	CLIP-seq
MIRT2049868	hsa-miR-4685-5p	CLIP-seq
MIRT2049871	hsa-miR-758	CLIP-seq
MIRT1172515	hsa-miR-4650-5p	CLIP-seq
MIRT1172519	hsa-miR-4740-3p	CLIP-seq
MIRT2577121	hsa-miR-122	CLIP-seq
MIRT2577122	hsa-miR-1228	CLIP-seq
MIRT2577123	hsa-miR-1276	CLIP-seq
MIRT2577124	hsa-miR-1294	CLIP-seq
MIRT2577125	hsa-miR-1321	CLIP-seq
MIRT2577126	hsa-miR-146b-3p	CLIP-seq
MIRT2577127	hsa-miR-147	CLIP-seq
MIRT2577128	hsa-miR-1827	CLIP-seq
MIRT2577129	hsa-miR-19a	CLIP-seq
MIRT2577130	hsa-miR-19b	CLIP-seq
MIRT2577131	hsa-miR-3123	CLIP-seq
MIRT2577132	hsa-miR-3126-5p	CLIP-seq
MIRT2577133	hsa-miR-3173-5p	CLIP-seq
MIRT2577134	hsa-miR-3612	CLIP-seq
MIRT2577135	hsa-miR-4254	CLIP-seq
MIRT2577136	hsa-miR-4308	CLIP-seq
MIRT2577137	hsa-miR-4311	CLIP-seq
MIRT2577138	hsa-miR-4313	CLIP-seq
MIRT2577139	hsa-miR-4316	CLIP-seq
MIRT2577140	hsa-miR-4419a	CLIP-seq
MIRT2577141	hsa-miR-4443	CLIP-seq
MIRT2577142	hsa-miR-4510	CLIP-seq
MIRT2577143	hsa-miR-4668-5p	CLIP-seq
MIRT2577144	hsa-miR-4728-5p	CLIP-seq
MIRT2577145	hsa-miR-4739	CLIP-seq
MIRT2577146	hsa-miR-4744	CLIP-seq
MIRT2577147	hsa-miR-4756-5p	CLIP-seq
MIRT2577148	hsa-miR-502-5p	CLIP-seq
MIRT2577149	hsa-miR-548q	CLIP-seq
MIRT2577150	hsa-miR-574-5p	CLIP-seq
MIRT2577151	hsa-miR-583	CLIP-seq
MIRT2577152	hsa-miR-650	CLIP-seq
MIRT2577153	hsa-miR-874	CLIP-seq
MIRT2577121	hsa-miR-122	CLIP-seq
MIRT2577122	hsa-miR-1228	CLIP-seq
MIRT2577123	hsa-miR-1276	CLIP-seq
MIRT2577124	hsa-miR-1294	CLIP-seq
MIRT2577125	hsa-miR-1321	CLIP-seq
MIRT2577126	hsa-miR-146b-3p	CLIP-seq
MIRT2577127	hsa-miR-147	CLIP-seq
MIRT2577128	hsa-miR-1827	CLIP-seq
MIRT2577129	hsa-miR-19a	CLIP-seq
MIRT2577130	hsa-miR-19b	CLIP-seq
MIRT2577131	hsa-miR-3123	CLIP-seq
MIRT2577132	hsa-miR-3126-5p	CLIP-seq
MIRT2577133	hsa-miR-3173-5p	CLIP-seq
MIRT2577134	hsa-miR-3612	CLIP-seq
MIRT2577135	hsa-miR-4254	CLIP-seq
MIRT2577136	hsa-miR-4308	CLIP-seq
MIRT2577137	hsa-miR-4311	CLIP-seq
MIRT2577139	hsa-miR-4316	CLIP-seq
MIRT2577140	hsa-miR-4419a	CLIP-seq
MIRT2577141	hsa-miR-4443	CLIP-seq
MIRT2577142	hsa-miR-4510	CLIP-seq
MIRT2577143	hsa-miR-4668-5p	CLIP-seq
MIRT2577144	hsa-miR-4728-5p	CLIP-seq
MIRT2577145	hsa-miR-4739	CLIP-seq
MIRT2577146	hsa-miR-4744	CLIP-seq
MIRT2577147	hsa-miR-4756-5p	CLIP-seq
MIRT2577149	hsa-miR-548q	CLIP-seq
MIRT2577150	hsa-miR-574-5p	CLIP-seq
MIRT2577151	hsa-miR-583	CLIP-seq
MIRT2577152	hsa-miR-650	CLIP-seq
MIRT2577153	hsa-miR-874	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
EGR1	Activation	16260776;20506119
EGR3	Activation	20506119

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001958	Process	Endochondral ossification	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003714	Function	Transcription corepressor activity	TAS	8668170
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0014037	Process	Schwann cell differentiation	IEA
GO:0016480	Process	Negative regulation of transcription by RNA polymerase III	IDA	8668170
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0045682	Process	Regulation of epidermis development	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA

MIM	HGNC	e!Ensembl
602381	7627	ENSG00000166886

Protein

UniProt ID

Q15742

Protein name

NGFI-A-binding protein 2 (EGR-1-binding protein 2) (Melanoma-associated delayed early response protein) (Protein MADER)

Protein function

Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04904	NCD1	36 → 114	NAB conserved region 1 (NCD1)	Domain
PF04905	NCD2	236 → 364	NAB conserved region 2 (NCD2)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at low levels. Highly expressed in melanoma cell lines.

Sequence

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYET
FIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAV
PVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAG
DPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPE
MVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI
IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSL
KGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSP
CVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ

Sequence length

525

Interactions

View interactions

	Reactome
			NGF-stimulated transcription EGR2 and SOX10-mediated initiation of Schwann cell myelination

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Insomnia	Insomnia	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adamantinoma	Associate	35303277
Bipolar Disorder	Stimulate	20633309
Breast Neoplasms	Associate	22431919, 25104439
Burkitt Lymphoma	Associate	15241441
Carcinoma Large Cell	Associate	33563892
Carcinoma Neuroendocrine	Associate	33563892
Cardiomyopathy Dilated	Stimulate	20392463
Disease	Associate	34502329
Epstein Barr Virus Infections	Associate	15241441
Gallbladder Neoplasms	Associate	33563892
Glioblastoma	Associate	26817999
Head and Neck Neoplasms	Associate	35303277
Hemangiopericytoma	Associate	26722515, 29600523, 30693881, 32843765
Lymphoma Non Hodgkin	Inhibit	17207284
Malignant mesenchymal tumor	Associate	33986460
Malignant Teratocarcinosarcoma	Associate	35303277
Melanoma	Associate	9730695
Meningioma	Associate	23860521
Myopathies Structural Congenital	Associate	22431919
Neoplasm Metastasis	Associate	29309807, 34502329
Neoplasms	Associate	17207284, 26022454, 26253700, 26337721, 27562490, 29700673, 30584643, 30693881, 34502329, 35303277, 9730695
Neuroblastoma	Associate	17207284
Pleuropulmonary blastoma	Associate	25432794, 26686340
Sarcoma	Associate	35238118
Sarcoma Ewing	Stimulate	17207284
Schizophrenia	Inhibit	20633309
Soft Tissue Neoplasms	Associate	37905637
Solitary Fibrous Tumors	Associate	23313952, 23313954, 23860521, 24434011, 24457460, 25432794, 26022454, 26226844, 26337721, 26686340, 26722515, 26817999, 27562490, 28494796, 28731041 View all (19 more)
Urogenital Neoplasms	Associate	27802414

NAB2 (NGFI-A binding protein 2)