Gene Gene information from NCBI Gene database.
Entrez ID 466
Gene name Activating transcription factor 1
Gene symbol ATF1
Synonyms (NCBI Gene)
EWS-ATF1FUS/ATF-1TREB36
Chromosome 12
Chromosome location 12q13.12
Summary This gene encodes an activating transcription factor, which belongs to the ATF subfamily and bZIP (basic-region leucine zipper) family. It influences cellular physiologic processes by regulating the expression of downstream target genes, which are related
miRNA miRNA information provided by mirtarbase database.
170
miRTarBase ID miRNA Experiments Reference
MIRT024634 hsa-miR-215-5p Microarray 19074876
MIRT026443 hsa-miR-192-5p Microarray 19074876
MIRT038958 hsa-miR-23a-5p CLASH 23622248
MIRT437453 hsa-miR-182-5p Luciferase reporter assay 23249749
MIRT732363 hsa-miR-30a-5p Luciferase reporter assayqRT-PCRWestern blot 28259977
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
EWSR1 Unknown 9569031
PIAS3 Activation 17565989
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 1655749
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
123803 783 ENSG00000123268
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P18846
Protein name Cyclic AMP-dependent transcription factor ATF-1 (cAMP-dependent transcription factor ATF-1) (Activating transcription factor 1) (Protein TREB36)
Protein function This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to the Tax-responsive element (TRE) of HTLV-I. Mediates PKA-induced stimulation of CRE-reporter
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02173 pKID 43 83 pKID domain Family
PF00170 bZIP_1 211 270 bZIP transcription factor Coiled-coil
Sequence
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDG
ENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKTLKDLYSNKS
V
Sequence length 271
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Aldosterone synthesis and secretion
Transcriptional misregulation in cancer
  CREB phosphorylation
NGF-stimulated transcription