Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
466
Gene name Gene Name - the full gene name approved by the HGNC.
Activating transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATF1
Synonyms (NCBI Gene) Gene synonyms aliases
EWS-ATF1, FUS/ATF-1, TREB36
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an activating transcription factor, which belongs to the ATF subfamily and bZIP (basic-region leucine zipper) family. It influences cellular physiologic processes by regulating the expression of downstream target genes, which are related
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024634 hsa-miR-215-5p Microarray 19074876
MIRT026443 hsa-miR-192-5p Microarray 19074876
MIRT038958 hsa-miR-23a-5p CLASH 23622248
MIRT437453 hsa-miR-182-5p Luciferase reporter assay 23249749
MIRT732363 hsa-miR-30a-5p Luciferase reporter assay, qRT-PCR, Western blot 28259977
Transcription factors
Transcription factor Regulation Reference
EWSR1 Unknown 9569031
PIAS3 Activation 17565989
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 1655749
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123803 783 ENSG00000123268
Protein
UniProt ID P18846
Protein name Cyclic AMP-dependent transcription factor ATF-1 (cAMP-dependent transcription factor ATF-1) (Activating transcription factor 1) (Protein TREB36)
Protein function This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to the Tax-responsive element (TRE) of HTLV-I. Mediates PKA-induced stimulation of CRE-reporter
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02173 pKID 43 83 pKID domain Family
PF00170 bZIP_1 211 270 bZIP transcription factor Coiled-coil
Sequence
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDG
ENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKTLKDLYSNKS
V
Sequence length 271
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Aldosterone synthesis and secretion
Transcriptional misregulation in cancer
  CREB phosphorylation
NGF-stimulated transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
3C syndrome Associate 35165059
Adenocarcinoma of Lung Associate 37158648
Carcinogenesis Associate 36041632
Carcinoma Renal Cell Associate 29076874, 29434341, 30047065, 31782119, 32720034, 33827033, 34251595, 35165059, 37479138
Colorectal Neoplasms Associate 22631637, 26553438, 29727690
COVID 19 Associate 38301615
Epstein Barr Virus Infections Stimulate 36154610
Esophageal Neoplasms Associate 28912415
Essential Hypertension Associate 26149214
Glomerulonephritis IGA Associate 38301615