Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4654
Gene name Gene Name - the full gene name approved by the HGNC.	Myogenic differentiation 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MYOD1
Synonyms (NCBI Gene) Gene synonyms aliases	CMYO17, CMYP17, MYF3, MYOD, MYODRIF, PUM, bHLHc1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CMYO17
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a nuclear protein that belongs to the basic helix-loop-helix family of transcription factors and the myogenic factors subfamily. It regulates muscle cell differentiation by inducing cell cycle arrest, a prerequisite for myogenic initiati

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1179926739	C>-,CC	Pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003570	hsa-miR-1-3p	Review	19815577
MIRT019143	hsa-miR-335-5p	Microarray	18185580
MIRT043226	hsa-miR-324-5p	CLASH	23622248
MIRT1170234	hsa-miR-1275	CLIP-seq
MIRT1170235	hsa-miR-29a	CLIP-seq
MIRT1170236	hsa-miR-29b	CLIP-seq
MIRT1170237	hsa-miR-29c	CLIP-seq
MIRT1170238	hsa-miR-3147	CLIP-seq
MIRT1170239	hsa-miR-3178	CLIP-seq
MIRT1170240	hsa-miR-320a	CLIP-seq
MIRT1170241	hsa-miR-320b	CLIP-seq
MIRT1170242	hsa-miR-320c	CLIP-seq
MIRT1170243	hsa-miR-320d	CLIP-seq
MIRT1170244	hsa-miR-329	CLIP-seq
MIRT1170245	hsa-miR-362-3p	CLIP-seq
MIRT1170246	hsa-miR-3689a-3p	CLIP-seq
MIRT1170247	hsa-miR-3689c	CLIP-seq
MIRT1170248	hsa-miR-3919	CLIP-seq
MIRT1170249	hsa-miR-4425	CLIP-seq
MIRT1170250	hsa-miR-4429	CLIP-seq
MIRT1170251	hsa-miR-4525	CLIP-seq
MIRT1170252	hsa-miR-4634	CLIP-seq
MIRT1170253	hsa-miR-4665-5p	CLIP-seq
MIRT1170254	hsa-miR-4723-5p	CLIP-seq
MIRT1170255	hsa-miR-4728-5p	CLIP-seq
MIRT1170256	hsa-miR-4756-3p	CLIP-seq
MIRT1170257	hsa-miR-625	CLIP-seq
MIRT1170255	hsa-miR-4728-5p	CLIP-seq
MIRT2454735	hsa-miR-3180	CLIP-seq
MIRT2454736	hsa-miR-3180-3p	CLIP-seq
MIRT2454737	hsa-miR-4258	CLIP-seq
MIRT2454738	hsa-miR-4277	CLIP-seq
MIRT2454739	hsa-miR-4713-5p	CLIP-seq
MIRT2454735	hsa-miR-3180	CLIP-seq
MIRT2454736	hsa-miR-3180-3p	CLIP-seq
MIRT2454737	hsa-miR-4258	CLIP-seq
MIRT2454738	hsa-miR-4277	CLIP-seq
MIRT2454739	hsa-miR-4713-5p	CLIP-seq
MIRT2454735	hsa-miR-3180	CLIP-seq
MIRT2454736	hsa-miR-3180-3p	CLIP-seq
MIRT2454737	hsa-miR-4258	CLIP-seq
MIRT2454738	hsa-miR-4277	CLIP-seq
MIRT2454739	hsa-miR-4713-5p	CLIP-seq

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000791	Component	Euchromatin	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11076940
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001102	Function	RNA polymerase II activating transcription factor binding	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11076940
GO:0003682	Function	Chromatin binding	ISS
GO:0005515	Function	Protein binding	IPI	10915743, 12887892, 32296183
GO:0005634	Component	Nucleus	TAS	3175662
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006468	Process	Protein phosphorylation	TAS	3175662
GO:0007517	Process	Muscle organ development	TAS	1846704
GO:0007518	Process	Myoblast fate determination	IEA
GO:0007519	Process	Skeletal muscle tissue development	TAS	3175662
GO:0007520	Process	Myoblast fusion	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0014904	Process	Myotube cell development	IDA	10672515
GO:0014908	Process	Myotube differentiation involved in skeletal muscle regeneration	IEA
GO:0030016	Component	Myofibril	IEA
GO:0031490	Function	Chromatin DNA binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0035257	Function	Nuclear hormone receptor binding	IPI	9862959
GO:0035562	Process	Negative regulation of chromatin binding	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IBA	21873635
GO:0042693	Process	Muscle cell fate commitment	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043415	Process	Positive regulation of skeletal muscle tissue regeneration	IEA
GO:0043484	Process	Regulation of RNA splicing	IDA	10672515
GO:0043503	Process	Skeletal muscle fiber adaptation	IEA
GO:0043966	Process	Histone H3 acetylation	ISS
GO:0043967	Process	Histone H4 acetylation	ISS
GO:0045663	Process	Positive regulation of myoblast differentiation	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11076940
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0048743	Process	Positive regulation of skeletal muscle fiber development	IBA	21873635
GO:0051099	Process	Positive regulation of binding	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	IDA	10672515
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0070888	Function	E-box binding	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	ISS
GO:0071453	Process	Cellular response to oxygen levels	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IDA	10672515
GO:1905382	Process	Positive regulation of snRNA transcription by RNA polymerase II	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	ISS
GO:2000818	Process	Negative regulation of myoblast proliferation	IEA

MIM	HGNC	e!Ensembl
159970	7611	ENSG00000129152

Protein

UniProt ID

P15172

Protein name

Myoblast determination protein 1 (Class C basic helix-loop-helix protein 1) (bHLHc1) (Myogenic factor 3) (Myf-3)

Protein function

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYF5 and MYOG, co-occupies muscle-specific gene promoter core region during myogenesis. Ind

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01586	Basic	27 → 109	Myogenic Basic domain	Family
PF00010	HLH	110 → 161	Helix-loop-helix DNA-binding domain	Domain
PF12232	Myf5	191 → 259	Myogenic determination factor 5	Family

Sequence

MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE
EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP
GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS
PDAAPQCPAGANPNPIYQVL

Sequence length

320

Interactions

View interactions

	KEGG		Reactome
	Spinocerebellar ataxia		Myogenesis

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Akinesia	Akinesia	rs606231129, rs606231131, rs606231132, rs118203995, rs606231133, rs104894299, rs104894300, rs786200904, rs786200905, rs104894294, rs121909254, rs121909255, rs121909256, rs150376433, rs863223335 View all (33 more)
Arthrogryposis multiplex congenita	Arthrogryposis	rs1586285494, rs80358233, rs137853305, rs1559154278, rs398124167, rs398124172, rs587780399, rs786204576, rs786204430, rs769345284, rs749355583, rs793888524, rs793888525, rs878854368, rs555445835 View all (138 more)
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	rs121908602, rs121908604, rs864309713, rs775394591	21258934
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Rhabdomyosarcoma	Rhabdomyosarcoma	rs137854557, rs121909224, rs63751466, rs11540652, rs28934874, rs104894229, rs104894230, rs267606708, rs80357867, rs276174889, rs80359011, rs80358556, rs80359391, rs80357989, rs886037650 View all (19 more)
Scoliosis	Scoliosis, unspecified	rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Pulmonary hypoplasia	Congenital hypoplasia of lung	ClinVar
Myopathy	myopathy, congenital, with diaphragmatic defects, respiratory insufficiency, and dysmorphic facies	GenCC
Fetal Akinesia Deformation Sequence	fetal akinesia deformation sequence 1	GenCC

Show/Hide Text Mining Associations (65)

Disease Name	Relationship Type	References
Associations from Text Mining
Amyotrophic Lateral Sclerosis	Associate	27195289
Astrocytoma	Associate	15367334
Brachial Plexus Neuropathies	Associate	37055794
Breast Neoplasms	Associate	18628976
Carcinoma	Associate	24824843, 26501226, 27562493, 30181563, 32859634, 35452896, 37315267
Carcinoma Lobular	Associate	18628976
Carcinoma Renal Cell	Associate	27562493
Carcinoma Squamous Cell	Associate	33896245
Carotid Stenosis	Associate	20966410
Colitis Ulcerative	Associate	21830274
Critical Illness	Associate	30992050
Cryopyrin Associated Periodic Syndromes	Inhibit	37380094
Death Sudden Cardiac	Associate	18758635
Desmoplastic Small Round Cell Tumor	Associate	7495304
Diaphyseal medullary stenosis with malignant fibrous histiocytoma	Associate	12401825
Esophageal Neoplasms	Associate	22430803
Esotropia	Associate	34044792
Fibrosis	Associate	22319435
Frailty	Associate	28869034
Genetic Diseases Inborn	Associate	21266958
Head and Neck Neoplasms	Associate	22430803, 27688110
Helicobacter Infections	Associate	27259265
Hemoglobin SC Disease	Associate	34782706
Immunoglobulin G4 Related Disease	Associate	19299559, 23230269
Insulin Resistance	Associate	23404842
Leiomyosarcoma	Associate	28884746
Leprosy Paucibacillary	Associate	2260621
Leukemia Myeloid Acute	Associate	11313277
Lymphoma Large B Cell Diffuse	Associate	18288132
Malignant Teratocarcinosarcoma	Associate	30829729, 36719455, 37378830
Medulloblastoma	Associate	21148633
Melanoma	Associate	15526363
Muscle Neoplasms	Associate	19299559, 20110400, 28869034
Muscular Atrophy	Associate	23404842
Muscular Atrophy	Stimulate	35800215
Muscular Diseases	Associate	27651888
Muscular Dystrophies	Associate	18334989, 24396035
Muscular Dystrophy Duchenne	Associate	18334989, 21266958, 24396035, 30846748, 32359374, 33610829, 38282008, 8361505
Muscular Dystrophy Facioscapulohumeral	Associate	17013991, 23561550
Myasthenia Gravis	Associate	30696470
Myasthenic Syndromes Congenital	Associate	27286495
Myocardial Stunning	Associate	18758635
Myositis Inclusion Body	Associate	17077152
Myositis Inclusion Body	Inhibit	23058947
Myostatin related muscle hypertrophy	Associate	28869034
Myotonic Dystrophy	Associate	27286495, 36631509, 36767649
Neoplasms	Associate	15526363, 16435141, 1764365, 18288132, 19750229, 20980337, 22542536, 23230269, 25197361, 26501226, 28540987, 30181563, 31383960, 33318583, 33913590 View all (7 more)
Neuroblastoma	Associate	7495304
Neuroectodermal Tumors Primitive Peripheral	Associate	36913073
Neurofibrosarcoma	Associate	38178234
Obesity	Associate	23404842
Prostatic Neoplasms	Associate	20053773
Pulmonary Disease Chronic Obstructive	Associate	17573449, 24666540, 34831227
Pulmonary Disease Chronic Obstructive	Inhibit	19717478
Rhabdomyosarcoma	Associate	17468105, 1764365, 19299559, 20701800, 2260621, 23230269, 24824843, 27286495, 27562493, 30181563, 30975722, 32859634, 33627785, 33913590, 34285060 View all (7 more)
Rhabdomyosarcoma Alveolar	Associate	18487991, 21321994, 23733015, 23999248, 34782706
Rhabdomyosarcoma Embryonal	Associate	11272905, 19299559, 20701800, 23733015, 27562493, 27764816, 34782706, 9546368
Sarcoma	Associate	8160771
Sarcoma Ewing	Associate	2260621
Scoliosis	Associate	32815649
Trochlear Nerve Diseases	Associate	29843669
Tuberculosis Multidrug Resistant	Associate	20980337
Turner Syndrome	Associate	23761422
Uterine Cervical Neoplasms	Associate	29806603
Wilms Tumor	Associate	2260621

MYOD1 (myogenic differentiation 1)