Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4650
Gene name Gene Name - the full gene name approved by the HGNC.	Myosin IXB
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MYO9B
Synonyms (NCBI Gene) Gene synonyms aliases	CELIAC4, MYR5
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the myosin family of actin-based molecular motor heavy chain proteins. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-9 (MYH9). The protein has four IQ motif

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2305764	G>A,C	Risk-factor	Intron variant

Show/Hide all(87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019067	hsa-miR-335-5p	Microarray	18185580
MIRT051699	hsa-let-7e-5p	CLASH	23622248
MIRT048837	hsa-miR-93-5p	CLASH	23622248
MIRT042019	hsa-miR-484	CLASH	23622248
MIRT715483	hsa-miR-193a-5p	HITS-CLIP	19536157
MIRT715482	hsa-miR-4714-5p	HITS-CLIP	19536157
MIRT715481	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715480	hsa-miR-412-3p	HITS-CLIP	19536157
MIRT715479	hsa-miR-6754-3p	HITS-CLIP	19536157
MIRT715478	hsa-miR-6837-3p	HITS-CLIP	19536157
MIRT715477	hsa-miR-615-5p	HITS-CLIP	19536157
MIRT715476	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT440161	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT440161	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT715483	hsa-miR-193a-5p	HITS-CLIP	19536157
MIRT715482	hsa-miR-4714-5p	HITS-CLIP	19536157
MIRT715481	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715480	hsa-miR-412-3p	HITS-CLIP	19536157
MIRT715479	hsa-miR-6754-3p	HITS-CLIP	19536157
MIRT715478	hsa-miR-6837-3p	HITS-CLIP	19536157
MIRT715477	hsa-miR-615-5p	HITS-CLIP	19536157
MIRT715476	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT1170165	hsa-miR-1237	CLIP-seq
MIRT1170166	hsa-miR-1248	CLIP-seq
MIRT1170167	hsa-miR-1270	CLIP-seq
MIRT1170168	hsa-miR-3616-3p	CLIP-seq
MIRT1170169	hsa-miR-3665	CLIP-seq
MIRT1170170	hsa-miR-3907	CLIP-seq
MIRT1170171	hsa-miR-3921	CLIP-seq
MIRT1170172	hsa-miR-4649-3p	CLIP-seq
MIRT1170173	hsa-miR-4653-5p	CLIP-seq
MIRT1170174	hsa-miR-4683	CLIP-seq
MIRT1170175	hsa-miR-4704-5p	CLIP-seq
MIRT1170176	hsa-miR-4721	CLIP-seq
MIRT1170177	hsa-miR-576-3p	CLIP-seq
MIRT1170178	hsa-miR-620	CLIP-seq
MIRT1170179	hsa-miR-942	CLIP-seq
MIRT1551556	hsa-miR-133a	CLIP-seq
MIRT1551557	hsa-miR-133b	CLIP-seq
MIRT1551558	hsa-miR-885-5p	CLIP-seq
MIRT2049044	hsa-miR-4687-3p	CLIP-seq
MIRT2049045	hsa-miR-561	CLIP-seq
MIRT2049046	hsa-miR-582-5p	CLIP-seq
MIRT1551558	hsa-miR-885-5p	CLIP-seq
MIRT2278125	hsa-miR-1224-3p	CLIP-seq
MIRT2278126	hsa-miR-1321	CLIP-seq
MIRT2278127	hsa-miR-149	CLIP-seq
MIRT2278128	hsa-miR-3130-3p	CLIP-seq
MIRT2278129	hsa-miR-3162-5p	CLIP-seq
MIRT2278130	hsa-miR-345	CLIP-seq
MIRT2278131	hsa-miR-3614-5p	CLIP-seq
MIRT2278132	hsa-miR-3651	CLIP-seq
MIRT2278133	hsa-miR-4260	CLIP-seq
MIRT2278134	hsa-miR-4325	CLIP-seq
MIRT2278135	hsa-miR-4522	CLIP-seq
MIRT2278136	hsa-miR-4739	CLIP-seq
MIRT2278137	hsa-miR-4756-5p	CLIP-seq
MIRT2278138	hsa-miR-4793-3p	CLIP-seq
MIRT2278139	hsa-miR-617	CLIP-seq
MIRT2278140	hsa-miR-766	CLIP-seq
MIRT2442388	hsa-miR-3163	CLIP-seq
MIRT2442389	hsa-miR-4643	CLIP-seq
MIRT2442390	hsa-miR-466	CLIP-seq
MIRT2442391	hsa-miR-4789-3p	CLIP-seq
MIRT2442392	hsa-miR-548aa	CLIP-seq
MIRT2442393	hsa-miR-548ac	CLIP-seq
MIRT2442394	hsa-miR-548d-3p	CLIP-seq
MIRT2442395	hsa-miR-548z	CLIP-seq
MIRT2685687	hsa-miR-1294	CLIP-seq
MIRT2685688	hsa-miR-1297	CLIP-seq
MIRT2685689	hsa-miR-181a	CLIP-seq
MIRT2685690	hsa-miR-181b	CLIP-seq
MIRT2685691	hsa-miR-181c	CLIP-seq
MIRT2685692	hsa-miR-181d	CLIP-seq
MIRT2685693	hsa-miR-26a	CLIP-seq
MIRT2685694	hsa-miR-26b	CLIP-seq
MIRT2278130	hsa-miR-345	CLIP-seq
MIRT2685695	hsa-miR-4262	CLIP-seq
MIRT2685696	hsa-miR-4287	CLIP-seq
MIRT2685697	hsa-miR-4292	CLIP-seq
MIRT2685698	hsa-miR-4308	CLIP-seq
MIRT2685699	hsa-miR-4465	CLIP-seq
MIRT2685700	hsa-miR-4469	CLIP-seq
MIRT2685701	hsa-miR-4685-3p	CLIP-seq
MIRT2685702	hsa-miR-4732-3p	CLIP-seq
MIRT2685703	hsa-miR-4749-3p	CLIP-seq
MIRT2685704	hsa-miR-564	CLIP-seq

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000146	Function	Microfilament motor activity	IBA
GO:0000146	Function	Microfilament motor activity	IDA	9490638, 11901422, 16338935, 16616011
GO:0000146	Function	Microfilament motor activity	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001726	Component	Ruffle	IBA
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003779	Function	Actin binding	IDA	9490638, 16338935, 16616011
GO:0003779	Function	Actin binding	IEA
GO:0005096	Function	GTPase activator activity	IDA	9490638, 15644318, 26529257
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	15644318, 16417406
GO:0005516	Function	Calmodulin binding	IDA	9490638, 16338935
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IDA	16338935
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	8907710
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IBA
GO:0005884	Component	Actin filament	IDA	8907710, 16338935, 16616011
GO:0005938	Component	Cell cortex	IDA	8907710
GO:0005938	Component	Cell cortex	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IC	9490638
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	8907710
GO:0016020	Component	Membrane	HDA	19946888
GO:0016459	Component	Myosin complex	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0030027	Component	Lamellipodium	IBA
GO:0030048	Process	Actin filament-based movement	IBA
GO:0030048	Process	Actin filament-based movement	IDA	9490638, 11901422, 16338935
GO:0030048	Process	Actin filament-based movement	IEA
GO:0030048	Process	Actin filament-based movement	TAS	8907710
GO:0031267	Function	Small GTPase binding	IPI	26529257
GO:0032011	Process	ARF protein signal transduction	IDA	15644318
GO:0035023	Process	Regulation of Rho protein signal transduction	IMP	26529257
GO:0035385	Process	Roundabout signaling pathway	IDA	26529257
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	11901422
GO:0043531	Function	ADP binding	IDA	16338935
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	8907710
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048495	Function	Roundabout binding	IPI	26529257
GO:0051015	Function	Actin filament binding	IBA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0072673	Process	Lamellipodium morphogenesis	IBA
GO:0098871	Component	Postsynaptic actin cytoskeleton	IDA	30123108
GO:0098871	Component	Postsynaptic actin cytoskeleton	IMP	30123108

MIM	HGNC	e!Ensembl
602129	7609	ENSG00000099331

Protein

UniProt ID

Q13459

Protein name

Unconventional myosin-IXb (Unconventional myosin-9b)

Protein function

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calciu

PDB

5C5S , 5HPY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00788	RA	15 → 114	Ras association (RalGDS/AF-6) domain	Domain
PF00063	Myosin_head	148 → 715	Myosin head (motor domain)	Domain
PF00063	Myosin_head	780 → 941	Myosin head (motor domain)	Domain
PF00612	IQ	957 → 977	IQ calmodulin-binding motif	Motif
PF00612	IQ	980 → 1000	IQ calmodulin-binding motif	Motif
PF00612	IQ	1002 → 1022	IQ calmodulin-binding motif	Motif
PF00612	IQ	1025 → 1045	IQ calmodulin-binding motif	Motif
PF00620	RhoGAP	1713 → 1863	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in peripheral blood leukocytes (at protein level) (PubMed:9490638). Expressed predominantly in peripheral blood leukocytes and at lower levels, in thymus, spleen, testis, prostate, ovary, brain, small intestine and lung. {ECO:

Sequence

MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGT
KCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
VHMQLVAQATATRRLVERGLLPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA
TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGMSSPGA
QSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKS
KGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKI
LLLQSWFRMVLERRHFLQMKRAAVTIQACWRSYRVRRALERTQAAVYLQASWRGYWQRKL
YRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEEKEREALEAARAGAEEGGQGQAAGG
QQVAEQGPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEK
VPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
ETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLERPTSLALDSRV
SPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVA
AASPSAMLSQSLDLSDRHRATGAALTPTEERRTSFSTSDVSKLLPSLAKAQPAAETTDGE
RSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENA
VSGHVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHV
GYKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKK
RKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSH
CSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAA
NRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
QEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDN
SDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPL
KLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDI
TYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPGAPTPSPLPTV
AAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP
ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG

Sequence length

2157

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		Rho GTPase cycle Regulation of actin dynamics for phagocytic cup formation SLIT2:ROBO1 increases RHOA activity FCGR3A-mediated phagocytosis

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Celiac disease	Celiac disease, susceptibility to, 4	N/A	N/A	ClinVar
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Gastric ulcer	Gastric ulcer	N/A	N/A	GWAS
Hypertension	Hypertension, Hypertension (confirmatory factor analysis Factor 12)	N/A	N/A	GWAS
Prostate cancer	Prostate cancer, Prostate cancer (early onset)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anal Gland Neoplasms	Associate	24966617
Autoimmune Diseases	Associate	19142207
Celiac Disease	Associate	23368647, 24386489
Colitis Ulcerative	Associate	24386489
Crohn Disease	Associate	24966617
Inflammatory Bowel Diseases	Associate	22573889, 24386489, 24966617
Neoplasm Metastasis	Associate	26811494
Pancreatitis	Associate	24386489
Prostatic Neoplasms	Associate	26670045
Stomach Neoplasms	Associate	26811494

MYO9B (myosin IXB)