Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4638
Gene name	Myosin light chain kinase
Gene symbol	MYLK
Synonyms (NCBI Gene)	AAT7KRPMLCKMLCK1MLCK108MLCK210MMIHSMMIHS1MSTP083MYLK-LMYLK1smMLCK
Chromosome	3
Chromosome location	3q21.1
Summary	This gene, a muscle member of the immunoglobulin gene superfamily, encodes myosin light chain kinase which is a calcium/calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin fila

Show/Hide all (23)

SNP ID	Visualize variation	Clinical significance	Consequence
rs56378658	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Coding sequence variant, missense variant, genic upstream transcript variant
rs78118111	G>A,C	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant, 5 prime UTR variant, genic upstream transcript variant
rs113607507	G>A	Conflicting-interpretations-of-pathogenicity, benign, likely-benign	Genic upstream transcript variant, intron variant
rs150378280	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Genic upstream transcript variant, coding sequence variant, synonymous variant
rs199988497	C>T	Benign, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant, genic upstream transcript variant
rs201754358	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, genic upstream transcript variant, missense variant, 5 prime UTR variant
rs368822172	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, intron variant, missense variant, genic upstream transcript variant
rs371602931	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Coding sequence variant, genic upstream transcript variant, synonymous variant
rs387906782	G>A	Pathogenic	Genic upstream transcript variant, coding sequence variant, stop gained, intron variant
rs761508149	G>A,C	Likely-pathogenic	Stop gained, genic upstream transcript variant, missense variant, coding sequence variant
rs778050996	G>A	Likely-pathogenic	5 prime UTR variant, coding sequence variant, stop gained, genic upstream transcript variant
rs886229659	G>A,C	Pathogenic	Intron variant, stop gained, missense variant, coding sequence variant, genic upstream transcript variant
rs928811814	G>A	Likely-pathogenic	Intron variant, missense variant, genic upstream transcript variant, coding sequence variant
rs1060502531	TATGC>-	Likely-pathogenic	Intron variant, frameshift variant, genic upstream transcript variant, coding sequence variant
rs1382893400	G>A	Pathogenic	Coding sequence variant, stop gained, genic upstream transcript variant
rs1430822242	C>T	Likely-pathogenic	Splice donor variant, genic upstream transcript variant
rs1553780501	A>C	Likely-pathogenic	Splice donor variant, genic upstream transcript variant, intron variant
rs1553781304	G>A	Pathogenic	Stop gained, genic upstream transcript variant, coding sequence variant
rs1553785222	->G	Likely-pathogenic	Frameshift variant, genic upstream transcript variant, coding sequence variant
rs1553787619	C>A	Pathogenic	Genic upstream transcript variant, intron variant
rs1553787823	->GCTTTCC	Pathogenic	Frameshift variant, genic upstream transcript variant, coding sequence variant
rs1576401641	G>A	Likely-pathogenic	Missense variant, coding sequence variant, genic upstream transcript variant
rs1576422965	C>A	Pathogenic	Intron variant, missense variant, coding sequence variant, genic upstream transcript variant

679

Show/Hide all (679)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016318	hsa-miR-193b-3p	Microarray	20304954
MIRT020526	hsa-miR-155-5p	Other	20584899
MIRT021378	hsa-miR-9-5p	Microarray	17612493
MIRT020526	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24486510
MIRT717749	hsa-miR-8063	HITS-CLIP	19536157
MIRT717748	hsa-miR-4691-3p	HITS-CLIP	19536157
MIRT717747	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT717746	hsa-miR-4251	HITS-CLIP	19536157
MIRT717745	hsa-miR-589-5p	HITS-CLIP	19536157
MIRT717744	hsa-miR-146a-5p	HITS-CLIP	19536157
MIRT717743	hsa-miR-146b-5p	HITS-CLIP	19536157
MIRT717742	hsa-miR-7153-5p	HITS-CLIP	19536157
MIRT717741	hsa-miR-4252	HITS-CLIP	19536157
MIRT717740	hsa-miR-4684-3p	HITS-CLIP	19536157
MIRT717739	hsa-miR-7156-3p	HITS-CLIP	19536157
MIRT717738	hsa-miR-1301-3p	HITS-CLIP	19536157
MIRT717737	hsa-miR-5047	HITS-CLIP	19536157
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT560564	hsa-miR-4328	PAR-CLIP	20371350
MIRT560563	hsa-miR-490-5p	PAR-CLIP	20371350
MIRT560562	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560560	hsa-miR-6077	PAR-CLIP	20371350
MIRT560561	hsa-miR-5581-3p	PAR-CLIP	20371350
MIRT560559	hsa-miR-587	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	22012620
MIRT483619	hsa-miR-5094	PAR-CLIP	22012620
MIRT499361	hsa-miR-136-3p	PAR-CLIP	22012620
MIRT483618	hsa-miR-1272	PAR-CLIP	22012620
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	22012620
MIRT483616	hsa-miR-5190	PAR-CLIP	22012620
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT483614	hsa-miR-4276	PAR-CLIP	22012620
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	24398324
MIRT483619	hsa-miR-5094	PAR-CLIP	24398324
MIRT499361	hsa-miR-136-3p	PAR-CLIP	24398324
MIRT483618	hsa-miR-1272	PAR-CLIP	24398324
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	24398324
MIRT483616	hsa-miR-5190	PAR-CLIP	24398324
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	24398324
MIRT483614	hsa-miR-4276	PAR-CLIP	24398324
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23592263
MIRT483619	hsa-miR-5094	PAR-CLIP	23592263
MIRT483618	hsa-miR-1272	PAR-CLIP	23592263
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23592263
MIRT483616	hsa-miR-5190	PAR-CLIP	23592263
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23592263
MIRT483614	hsa-miR-4276	PAR-CLIP	23592263
MIRT736129	hsa-miR-200c-3p	ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	26334100
MIRT736129	hsa-miR-200c-3p	ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	26334100
MIRT736129	hsa-miR-200c-3p	ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	26334100
MIRT717738	hsa-miR-1301-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRIn situ hybridization	32547198
MIRT736131	hsa-miR-155-3p	MicroarrayqRT-PCR	31795319
MIRT737219	hsa-miR-29a-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCRIn situ hybridizationFlow cytometry	32904604
MIRT717749	hsa-miR-8063	HITS-CLIP	19536157
MIRT717748	hsa-miR-4691-3p	HITS-CLIP	19536157
MIRT717747	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT717746	hsa-miR-4251	HITS-CLIP	19536157
MIRT717745	hsa-miR-589-5p	HITS-CLIP	19536157
MIRT717744	hsa-miR-146a-5p	HITS-CLIP	19536157
MIRT717743	hsa-miR-146b-5p	HITS-CLIP	19536157
MIRT717742	hsa-miR-7153-5p	HITS-CLIP	19536157
MIRT717741	hsa-miR-4252	HITS-CLIP	19536157
MIRT717740	hsa-miR-4684-3p	HITS-CLIP	19536157
MIRT717739	hsa-miR-7156-3p	HITS-CLIP	19536157
MIRT717738	hsa-miR-1301-3p	HITS-CLIP	19536157
MIRT717737	hsa-miR-5047	HITS-CLIP	19536157
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT560564	hsa-miR-4328	PAR-CLIP	20371350
MIRT560563	hsa-miR-490-5p	PAR-CLIP	20371350
MIRT560562	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560560	hsa-miR-6077	PAR-CLIP	20371350
MIRT560561	hsa-miR-5581-3p	PAR-CLIP	20371350
MIRT560559	hsa-miR-587	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT483619	hsa-miR-5094	PAR-CLIP	20371350
MIRT499361	hsa-miR-136-3p	PAR-CLIP	20371350
MIRT483618	hsa-miR-1272	PAR-CLIP	20371350
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	20371350
MIRT483616	hsa-miR-5190	PAR-CLIP	20371350
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT483614	hsa-miR-4276	PAR-CLIP	20371350
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	22012620
MIRT483619	hsa-miR-5094	PAR-CLIP	22012620
MIRT499361	hsa-miR-136-3p	PAR-CLIP	22012620
MIRT483618	hsa-miR-1272	PAR-CLIP	22012620
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	22012620
MIRT483616	hsa-miR-5190	PAR-CLIP	22012620
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT483614	hsa-miR-4276	PAR-CLIP	22012620
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT483619	hsa-miR-5094	PAR-CLIP	23446348
MIRT499361	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT483618	hsa-miR-1272	PAR-CLIP	23446348
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT483616	hsa-miR-5190	PAR-CLIP	23446348
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT483614	hsa-miR-4276	PAR-CLIP	23446348
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	24398324
MIRT483619	hsa-miR-5094	PAR-CLIP	24398324
MIRT499361	hsa-miR-136-3p	PAR-CLIP	24398324
MIRT483618	hsa-miR-1272	PAR-CLIP	24398324
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	24398324
MIRT483616	hsa-miR-5190	PAR-CLIP	24398324
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	24398324
MIRT483614	hsa-miR-4276	PAR-CLIP	24398324
MIRT483620	hsa-miR-513b-3p	PAR-CLIP	23592263
MIRT483619	hsa-miR-5094	PAR-CLIP	23592263
MIRT483618	hsa-miR-1272	PAR-CLIP	23592263
MIRT483617	hsa-miR-4717-3p	PAR-CLIP	23592263
MIRT483616	hsa-miR-5190	PAR-CLIP	23592263
MIRT483615	hsa-miR-3682-3p	PAR-CLIP	23592263
MIRT483614	hsa-miR-4276	PAR-CLIP	23592263
MIRT717747	hsa-miR-181a-2-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)Immunohistochemistry (IHC)in vitro cullelar assays	34733825
MIRT1168781	hsa-miR-1273d	CLIP-seq
MIRT1168782	hsa-miR-127-5p	CLIP-seq
MIRT1168783	hsa-miR-1290	CLIP-seq
MIRT1168784	hsa-miR-194	CLIP-seq
MIRT1168785	hsa-miR-25	CLIP-seq
MIRT1168786	hsa-miR-3159	CLIP-seq
MIRT1168787	hsa-miR-32	CLIP-seq
MIRT1168788	hsa-miR-363	CLIP-seq
MIRT1168789	hsa-miR-367	CLIP-seq
MIRT1168790	hsa-miR-3688-3p	CLIP-seq
MIRT1168791	hsa-miR-3910	CLIP-seq
MIRT1168792	hsa-miR-4325	CLIP-seq
MIRT1168793	hsa-miR-4446-5p	CLIP-seq
MIRT1168794	hsa-miR-4643	CLIP-seq
MIRT1168795	hsa-miR-4775	CLIP-seq
MIRT1168796	hsa-miR-4789-3p	CLIP-seq
MIRT1168797	hsa-miR-490-3p	CLIP-seq
MIRT1168798	hsa-miR-590-3p	CLIP-seq
MIRT1168799	hsa-miR-649	CLIP-seq
MIRT1168800	hsa-miR-654-3p	CLIP-seq
MIRT1168801	hsa-miR-92a	CLIP-seq
MIRT1168802	hsa-miR-92b	CLIP-seq
MIRT1168781	hsa-miR-1273d	CLIP-seq
MIRT1168783	hsa-miR-1290	CLIP-seq
MIRT1168803	hsa-miR-2355-5p	CLIP-seq
MIRT1168804	hsa-miR-326	CLIP-seq
MIRT1168805	hsa-miR-330-5p	CLIP-seq
MIRT1168790	hsa-miR-3688-3p	CLIP-seq
MIRT1168806	hsa-miR-3914	CLIP-seq
MIRT1168793	hsa-miR-4446-5p	CLIP-seq
MIRT1168807	hsa-miR-873	CLIP-seq
MIRT1168781	hsa-miR-1273d	CLIP-seq
MIRT1168808	hsa-miR-129-5p	CLIP-seq
MIRT1168809	hsa-miR-1303	CLIP-seq
MIRT1168810	hsa-miR-3121-3p	CLIP-seq
MIRT1168811	hsa-miR-3123	CLIP-seq
MIRT1168812	hsa-miR-3145-3p	CLIP-seq
MIRT1168813	hsa-miR-3160-3p	CLIP-seq
MIRT1168814	hsa-miR-3649	CLIP-seq
MIRT1168815	hsa-miR-3653	CLIP-seq
MIRT1168816	hsa-miR-3658	CLIP-seq
MIRT1168790	hsa-miR-3688-3p	CLIP-seq
MIRT1168817	hsa-miR-3925-5p	CLIP-seq
MIRT1168818	hsa-miR-4421	CLIP-seq
MIRT1168819	hsa-miR-492	CLIP-seq
MIRT1168820	hsa-miR-495	CLIP-seq
MIRT1168821	hsa-miR-548c-3p	CLIP-seq
MIRT1168822	hsa-miR-577	CLIP-seq
MIRT1168823	hsa-miR-7	CLIP-seq
MIRT1551514	hsa-miR-155	CLIP-seq
MIRT1168812	hsa-miR-3145-3p	CLIP-seq
MIRT1168813	hsa-miR-3160-3p	CLIP-seq
MIRT1551515	hsa-miR-331-5p	CLIP-seq
MIRT1551516	hsa-miR-365	CLIP-seq
MIRT1551517	hsa-miR-376c	CLIP-seq
MIRT1551518	hsa-miR-4641	CLIP-seq
MIRT1551519	hsa-miR-4678	CLIP-seq
MIRT1551520	hsa-miR-4803	CLIP-seq
MIRT1168810	hsa-miR-3121-3p	CLIP-seq
MIRT2048561	hsa-miR-4762-3p	CLIP-seq
MIRT1551520	hsa-miR-4803	CLIP-seq
MIRT2277463	hsa-miR-15a	CLIP-seq
MIRT2277464	hsa-miR-15b	CLIP-seq
MIRT2277465	hsa-miR-16	CLIP-seq
MIRT2277466	hsa-miR-195	CLIP-seq
MIRT2277467	hsa-miR-208a	CLIP-seq
MIRT2277468	hsa-miR-208b	CLIP-seq
MIRT2277469	hsa-miR-424	CLIP-seq
MIRT2277470	hsa-miR-4291	CLIP-seq
MIRT2277471	hsa-miR-4305	CLIP-seq
MIRT2277472	hsa-miR-4432	CLIP-seq
MIRT2277473	hsa-miR-4524	CLIP-seq
MIRT2277474	hsa-miR-4637	CLIP-seq
MIRT2277475	hsa-miR-4738-3p	CLIP-seq
MIRT2277476	hsa-miR-497	CLIP-seq
MIRT2277477	hsa-miR-499-5p	CLIP-seq
MIRT2277478	hsa-miR-503	CLIP-seq
MIRT2277479	hsa-miR-545	CLIP-seq
MIRT2277480	hsa-miR-548p	CLIP-seq
MIRT1168822	hsa-miR-577	CLIP-seq
MIRT2277481	hsa-miR-646	CLIP-seq
MIRT2431321	hsa-miR-1	CLIP-seq
MIRT2431322	hsa-miR-106a	CLIP-seq
MIRT2431323	hsa-miR-106b	CLIP-seq
MIRT2431324	hsa-miR-1184	CLIP-seq
MIRT2431325	hsa-miR-1204	CLIP-seq
MIRT2431326	hsa-miR-1205	CLIP-seq
MIRT2431327	hsa-miR-1207-5p	CLIP-seq
MIRT2431328	hsa-miR-1270	CLIP-seq
MIRT1168781	hsa-miR-1273d	CLIP-seq
MIRT1168808	hsa-miR-129-5p	CLIP-seq
MIRT2431329	hsa-miR-1297	CLIP-seq
MIRT1168809	hsa-miR-1303	CLIP-seq
MIRT2431330	hsa-miR-1323	CLIP-seq
MIRT2431331	hsa-miR-139-5p	CLIP-seq
MIRT2431332	hsa-miR-140-3p	CLIP-seq
MIRT2431333	hsa-miR-142-3p	CLIP-seq
MIRT2431334	hsa-miR-142-5p	CLIP-seq
MIRT1551514	hsa-miR-155	CLIP-seq
MIRT2277463	hsa-miR-15a	CLIP-seq
MIRT2277464	hsa-miR-15b	CLIP-seq
MIRT2277465	hsa-miR-16	CLIP-seq
MIRT2431335	hsa-miR-17	CLIP-seq
MIRT2431336	hsa-miR-185	CLIP-seq
MIRT2431337	hsa-miR-18a	CLIP-seq
MIRT2431338	hsa-miR-18b	CLIP-seq
MIRT2431339	hsa-miR-192	CLIP-seq
MIRT1168784	hsa-miR-194	CLIP-seq
MIRT2277466	hsa-miR-195	CLIP-seq
MIRT2431340	hsa-miR-203	CLIP-seq
MIRT2431341	hsa-miR-206	CLIP-seq
MIRT2431342	hsa-miR-20a	CLIP-seq
MIRT2431343	hsa-miR-20b	CLIP-seq
MIRT2431344	hsa-miR-2117	CLIP-seq
MIRT2431345	hsa-miR-215	CLIP-seq
MIRT2431346	hsa-miR-219-2-3p	CLIP-seq
MIRT2431347	hsa-miR-22	CLIP-seq
MIRT2431348	hsa-miR-2276	CLIP-seq
MIRT2431349	hsa-miR-24	CLIP-seq
MIRT1168785	hsa-miR-25	CLIP-seq
MIRT2431350	hsa-miR-26a	CLIP-seq
MIRT2431351	hsa-miR-26b	CLIP-seq
MIRT2431352	hsa-miR-2964a-3p	CLIP-seq
MIRT1168810	hsa-miR-3121-3p	CLIP-seq
MIRT1168811	hsa-miR-3123	CLIP-seq
MIRT2431353	hsa-miR-3125	CLIP-seq
MIRT2431354	hsa-miR-3140-3p	CLIP-seq
MIRT1168812	hsa-miR-3145-3p	CLIP-seq
MIRT2431355	hsa-miR-3158-5p	CLIP-seq
MIRT1168786	hsa-miR-3159	CLIP-seq
MIRT1168813	hsa-miR-3160-3p	CLIP-seq
MIRT2431356	hsa-miR-3160-5p	CLIP-seq
MIRT2431357	hsa-miR-3185	CLIP-seq
MIRT1168787	hsa-miR-32	CLIP-seq
MIRT2431358	hsa-miR-329	CLIP-seq
MIRT2431359	hsa-miR-339-3p	CLIP-seq
MIRT2431360	hsa-miR-3609	CLIP-seq
MIRT2431361	hsa-miR-361-5p	CLIP-seq
MIRT2431362	hsa-miR-362-3p	CLIP-seq
MIRT1168788	hsa-miR-363	CLIP-seq
MIRT2431363	hsa-miR-3646	CLIP-seq
MIRT1551516	hsa-miR-365	CLIP-seq
MIRT1168815	hsa-miR-3653	CLIP-seq
MIRT1168816	hsa-miR-3658	CLIP-seq
MIRT2431364	hsa-miR-3659	CLIP-seq
MIRT1168789	hsa-miR-367	CLIP-seq
MIRT2431365	hsa-miR-3673	CLIP-seq
MIRT2431366	hsa-miR-3685	CLIP-seq
MIRT1168790	hsa-miR-3688-3p	CLIP-seq
MIRT1551517	hsa-miR-376c	CLIP-seq
MIRT2431367	hsa-miR-384	CLIP-seq
MIRT1168791	hsa-miR-3910	CLIP-seq
MIRT2431368	hsa-miR-3916	CLIP-seq
MIRT2431369	hsa-miR-3923	CLIP-seq
MIRT2431370	hsa-miR-3925-3p	CLIP-seq
MIRT1168817	hsa-miR-3925-5p	CLIP-seq
MIRT2431371	hsa-miR-3926	CLIP-seq
MIRT2431372	hsa-miR-3941	CLIP-seq
MIRT2431373	hsa-miR-3942-3p	CLIP-seq
MIRT2431374	hsa-miR-409-5p	CLIP-seq
MIRT2277469	hsa-miR-424	CLIP-seq
MIRT2431375	hsa-miR-4255	CLIP-seq
MIRT2431376	hsa-miR-4267	CLIP-seq
MIRT2431377	hsa-miR-4273	CLIP-seq
MIRT2431378	hsa-miR-4275	CLIP-seq
MIRT2431379	hsa-miR-4284	CLIP-seq
MIRT2431380	hsa-miR-4299	CLIP-seq
MIRT2277471	hsa-miR-4305	CLIP-seq
MIRT2431381	hsa-miR-4306	CLIP-seq
MIRT2431382	hsa-miR-4318	CLIP-seq
MIRT1168792	hsa-miR-4325	CLIP-seq
MIRT2431383	hsa-miR-433	CLIP-seq
MIRT2431384	hsa-miR-4434	CLIP-seq
MIRT1168793	hsa-miR-4446-5p	CLIP-seq
MIRT2431385	hsa-miR-4465	CLIP-seq
MIRT2431386	hsa-miR-4487	CLIP-seq
MIRT2431387	hsa-miR-4516	CLIP-seq
MIRT2431388	hsa-miR-4517	CLIP-seq
MIRT2277473	hsa-miR-4524	CLIP-seq
MIRT2431389	hsa-miR-4531	CLIP-seq
MIRT2431390	hsa-miR-4540	CLIP-seq
MIRT1551518	hsa-miR-4641	CLIP-seq
MIRT1168794	hsa-miR-4643	CLIP-seq
MIRT2431391	hsa-miR-4644	CLIP-seq
MIRT2431392	hsa-miR-4653-3p	CLIP-seq
MIRT2431393	hsa-miR-466	CLIP-seq
MIRT2431394	hsa-miR-4668-3p	CLIP-seq
MIRT2431395	hsa-miR-4672	CLIP-seq
MIRT2431396	hsa-miR-4693-3p	CLIP-seq
MIRT2431397	hsa-miR-4693-5p	CLIP-seq
MIRT2431398	hsa-miR-4704-3p	CLIP-seq
MIRT2431399	hsa-miR-4704-5p	CLIP-seq
MIRT2431400	hsa-miR-4719	CLIP-seq
MIRT2431401	hsa-miR-4729	CLIP-seq
MIRT2431402	hsa-miR-4735-3p	CLIP-seq
MIRT2431403	hsa-miR-4736	CLIP-seq
MIRT2277475	hsa-miR-4738-3p	CLIP-seq
MIRT2431404	hsa-miR-4755-5p	CLIP-seq
MIRT2431405	hsa-miR-4760-5p	CLIP-seq
MIRT2048561	hsa-miR-4762-3p	CLIP-seq
MIRT2431406	hsa-miR-4763-3p	CLIP-seq
MIRT2431407	hsa-miR-4768-5p	CLIP-seq
MIRT2431408	hsa-miR-4772-3p	CLIP-seq
MIRT1168795	hsa-miR-4775	CLIP-seq
MIRT1168796	hsa-miR-4789-3p	CLIP-seq
MIRT2431409	hsa-miR-4793-3p	CLIP-seq
MIRT2431410	hsa-miR-4796-3p	CLIP-seq
MIRT2431411	hsa-miR-4802-3p	CLIP-seq
MIRT1551520	hsa-miR-4803	CLIP-seq
MIRT1168797	hsa-miR-490-3p	CLIP-seq
MIRT2277476	hsa-miR-497	CLIP-seq
MIRT2277478	hsa-miR-503	CLIP-seq
MIRT2431412	hsa-miR-515-5p	CLIP-seq
MIRT2431413	hsa-miR-518a-5p	CLIP-seq
MIRT2431414	hsa-miR-519d	CLIP-seq
MIRT2431415	hsa-miR-527	CLIP-seq
MIRT2431416	hsa-miR-539	CLIP-seq
MIRT2277479	hsa-miR-545	CLIP-seq
MIRT2431417	hsa-miR-548a-3p	CLIP-seq
MIRT2431418	hsa-miR-548ag	CLIP-seq
MIRT2431419	hsa-miR-548ah	CLIP-seq
MIRT2431420	hsa-miR-548ai	CLIP-seq
MIRT1168821	hsa-miR-548c-3p	CLIP-seq
MIRT2431421	hsa-miR-548e	CLIP-seq
MIRT2431422	hsa-miR-548f	CLIP-seq
MIRT2431423	hsa-miR-548k	CLIP-seq
MIRT2431424	hsa-miR-548o	CLIP-seq
MIRT2277480	hsa-miR-548p	CLIP-seq
MIRT2431425	hsa-miR-548s	CLIP-seq
MIRT2431426	hsa-miR-558	CLIP-seq
MIRT1168822	hsa-miR-577	CLIP-seq
MIRT2431427	hsa-miR-580	CLIP-seq
MIRT2431428	hsa-miR-582-5p	CLIP-seq
MIRT2431429	hsa-miR-583	CLIP-seq
MIRT2431430	hsa-miR-584	CLIP-seq
MIRT1168798	hsa-miR-590-3p	CLIP-seq
MIRT2431431	hsa-miR-603	CLIP-seq
MIRT2431432	hsa-miR-613	CLIP-seq
MIRT2431433	hsa-miR-620	CLIP-seq
MIRT2277481	hsa-miR-646	CLIP-seq
MIRT1168799	hsa-miR-649	CLIP-seq
MIRT2431434	hsa-miR-659	CLIP-seq
MIRT2431435	hsa-miR-766	CLIP-seq
MIRT2431436	hsa-miR-889	CLIP-seq
MIRT2431437	hsa-miR-892a	CLIP-seq
MIRT2431438	hsa-miR-9	CLIP-seq
MIRT1168801	hsa-miR-92a	CLIP-seq
MIRT1168802	hsa-miR-92b	CLIP-seq
MIRT2431439	hsa-miR-93	CLIP-seq
MIRT2431322	hsa-miR-106a	CLIP-seq
MIRT2431323	hsa-miR-106b	CLIP-seq
MIRT2431324	hsa-miR-1184	CLIP-seq
MIRT2431326	hsa-miR-1205	CLIP-seq
MIRT2431327	hsa-miR-1207-5p	CLIP-seq
MIRT2576312	hsa-miR-1287	CLIP-seq
MIRT2431330	hsa-miR-1323	CLIP-seq
MIRT2431334	hsa-miR-142-5p	CLIP-seq
MIRT2277463	hsa-miR-15a	CLIP-seq
MIRT2277464	hsa-miR-15b	CLIP-seq
MIRT2277465	hsa-miR-16	CLIP-seq
MIRT2431335	hsa-miR-17	CLIP-seq
MIRT2431336	hsa-miR-185	CLIP-seq
MIRT2277466	hsa-miR-195	CLIP-seq
MIRT2431342	hsa-miR-20a	CLIP-seq
MIRT2431343	hsa-miR-20b	CLIP-seq
MIRT2576313	hsa-miR-2114	CLIP-seq
MIRT2576314	hsa-miR-2116	CLIP-seq
MIRT2431346	hsa-miR-219-2-3p	CLIP-seq
MIRT2431349	hsa-miR-24	CLIP-seq
MIRT1168785	hsa-miR-25	CLIP-seq
MIRT2431352	hsa-miR-2964a-3p	CLIP-seq
MIRT2576315	hsa-miR-302f	CLIP-seq
MIRT1168810	hsa-miR-3121-3p	CLIP-seq
MIRT2576316	hsa-miR-3135b	CLIP-seq
MIRT2576317	hsa-miR-3148	CLIP-seq
MIRT2576318	hsa-miR-3153	CLIP-seq
MIRT2431355	hsa-miR-3158-5p	CLIP-seq
MIRT1168786	hsa-miR-3159	CLIP-seq
MIRT2431356	hsa-miR-3160-5p	CLIP-seq
MIRT2576319	hsa-miR-3179	CLIP-seq
MIRT2431357	hsa-miR-3185	CLIP-seq
MIRT2576320	hsa-miR-3190	CLIP-seq
MIRT1168787	hsa-miR-32	CLIP-seq
MIRT2576321	hsa-miR-3202	CLIP-seq
MIRT2431360	hsa-miR-3609	CLIP-seq
MIRT1168788	hsa-miR-363	CLIP-seq
MIRT2431363	hsa-miR-3646	CLIP-seq
MIRT2576322	hsa-miR-3665	CLIP-seq
MIRT1168789	hsa-miR-367	CLIP-seq
MIRT2431365	hsa-miR-3673	CLIP-seq
MIRT2431373	hsa-miR-3942-3p	CLIP-seq
MIRT2277469	hsa-miR-424	CLIP-seq
MIRT2431379	hsa-miR-4284	CLIP-seq
MIRT2431381	hsa-miR-4306	CLIP-seq
MIRT2576323	hsa-miR-4311	CLIP-seq
MIRT2431382	hsa-miR-4318	CLIP-seq
MIRT1168792	hsa-miR-4325	CLIP-seq
MIRT2277472	hsa-miR-4432	CLIP-seq
MIRT2576324	hsa-miR-4477b	CLIP-seq
MIRT2277473	hsa-miR-4524	CLIP-seq
MIRT2576325	hsa-miR-4533	CLIP-seq
MIRT2431391	hsa-miR-4644	CLIP-seq
MIRT2576326	hsa-miR-4680-5p	CLIP-seq
MIRT2431396	hsa-miR-4693-3p	CLIP-seq
MIRT2431397	hsa-miR-4693-5p	CLIP-seq
MIRT2576327	hsa-miR-4694-3p	CLIP-seq
MIRT2431403	hsa-miR-4736	CLIP-seq
MIRT2277475	hsa-miR-4738-3p	CLIP-seq
MIRT2048561	hsa-miR-4762-3p	CLIP-seq
MIRT2431406	hsa-miR-4763-3p	CLIP-seq
MIRT1168795	hsa-miR-4775	CLIP-seq
MIRT2431410	hsa-miR-4796-3p	CLIP-seq
MIRT1551520	hsa-miR-4803	CLIP-seq
MIRT2277476	hsa-miR-497	CLIP-seq
MIRT2277477	hsa-miR-499-5p	CLIP-seq
MIRT2277478	hsa-miR-503	CLIP-seq
MIRT2431414	hsa-miR-519d	CLIP-seq
MIRT2576328	hsa-miR-520d-5p	CLIP-seq
MIRT2576329	hsa-miR-524-5p	CLIP-seq
MIRT2431416	hsa-miR-539	CLIP-seq
MIRT2277479	hsa-miR-545	CLIP-seq
MIRT2431417	hsa-miR-548a-3p	CLIP-seq
MIRT2431419	hsa-miR-548ah	CLIP-seq
MIRT1168821	hsa-miR-548c-3p	CLIP-seq
MIRT2431421	hsa-miR-548e	CLIP-seq
MIRT2431422	hsa-miR-548f	CLIP-seq
MIRT2431424	hsa-miR-548o	CLIP-seq
MIRT2277480	hsa-miR-548p	CLIP-seq
MIRT1168822	hsa-miR-577	CLIP-seq
MIRT1168798	hsa-miR-590-3p	CLIP-seq
MIRT2277481	hsa-miR-646	CLIP-seq
MIRT2431434	hsa-miR-659	CLIP-seq
MIRT1168823	hsa-miR-7	CLIP-seq
MIRT2431437	hsa-miR-892a	CLIP-seq
MIRT1168801	hsa-miR-92a	CLIP-seq
MIRT1168802	hsa-miR-92b	CLIP-seq
MIRT2431439	hsa-miR-93	CLIP-seq
MIRT2431322	hsa-miR-106a	CLIP-seq
MIRT2431323	hsa-miR-106b	CLIP-seq
MIRT2431324	hsa-miR-1184	CLIP-seq
MIRT2431326	hsa-miR-1205	CLIP-seq
MIRT2431327	hsa-miR-1207-5p	CLIP-seq
MIRT2576312	hsa-miR-1287	CLIP-seq
MIRT2431330	hsa-miR-1323	CLIP-seq
MIRT2431334	hsa-miR-142-5p	CLIP-seq
MIRT1551514	hsa-miR-155	CLIP-seq
MIRT2277463	hsa-miR-15a	CLIP-seq
MIRT2277464	hsa-miR-15b	CLIP-seq
MIRT2277465	hsa-miR-16	CLIP-seq
MIRT2431335	hsa-miR-17	CLIP-seq
MIRT2431336	hsa-miR-185	CLIP-seq
MIRT2277466	hsa-miR-195	CLIP-seq
MIRT2431342	hsa-miR-20a	CLIP-seq
MIRT2431343	hsa-miR-20b	CLIP-seq
MIRT2576314	hsa-miR-2116	CLIP-seq
MIRT2431346	hsa-miR-219-2-3p	CLIP-seq
MIRT2431349	hsa-miR-24	CLIP-seq
MIRT1168785	hsa-miR-25	CLIP-seq
MIRT2431352	hsa-miR-2964a-3p	CLIP-seq
MIRT2576315	hsa-miR-302f	CLIP-seq
MIRT1168810	hsa-miR-3121-3p	CLIP-seq
MIRT2576316	hsa-miR-3135b	CLIP-seq
MIRT2576318	hsa-miR-3153	CLIP-seq
MIRT2431355	hsa-miR-3158-5p	CLIP-seq
MIRT1168786	hsa-miR-3159	CLIP-seq
MIRT2431356	hsa-miR-3160-5p	CLIP-seq
MIRT2576319	hsa-miR-3179	CLIP-seq
MIRT2576320	hsa-miR-3190	CLIP-seq
MIRT1168787	hsa-miR-32	CLIP-seq
MIRT2576321	hsa-miR-3202	CLIP-seq
MIRT1551515	hsa-miR-331-5p	CLIP-seq
MIRT2431360	hsa-miR-3609	CLIP-seq
MIRT1168788	hsa-miR-363	CLIP-seq
MIRT2431363	hsa-miR-3646	CLIP-seq
MIRT1551516	hsa-miR-365	CLIP-seq
MIRT2576322	hsa-miR-3665	CLIP-seq
MIRT1168789	hsa-miR-367	CLIP-seq
MIRT2431365	hsa-miR-3673	CLIP-seq
MIRT1551517	hsa-miR-376c	CLIP-seq
MIRT2431373	hsa-miR-3942-3p	CLIP-seq
MIRT2277469	hsa-miR-424	CLIP-seq
MIRT2431379	hsa-miR-4284	CLIP-seq
MIRT2431381	hsa-miR-4306	CLIP-seq
MIRT2576323	hsa-miR-4311	CLIP-seq
MIRT2431382	hsa-miR-4318	CLIP-seq
MIRT1168792	hsa-miR-4325	CLIP-seq
MIRT2576324	hsa-miR-4477b	CLIP-seq
MIRT2277473	hsa-miR-4524	CLIP-seq
MIRT2576325	hsa-miR-4533	CLIP-seq
MIRT1551518	hsa-miR-4641	CLIP-seq
MIRT2431391	hsa-miR-4644	CLIP-seq
MIRT1551519	hsa-miR-4678	CLIP-seq
MIRT2576326	hsa-miR-4680-5p	CLIP-seq
MIRT2431396	hsa-miR-4693-3p	CLIP-seq
MIRT2431397	hsa-miR-4693-5p	CLIP-seq
MIRT2576327	hsa-miR-4694-3p	CLIP-seq
MIRT2431403	hsa-miR-4736	CLIP-seq
MIRT2277475	hsa-miR-4738-3p	CLIP-seq
MIRT2431406	hsa-miR-4763-3p	CLIP-seq
MIRT1168795	hsa-miR-4775	CLIP-seq
MIRT2431410	hsa-miR-4796-3p	CLIP-seq
MIRT1551520	hsa-miR-4803	CLIP-seq
MIRT2277476	hsa-miR-497	CLIP-seq
MIRT2277478	hsa-miR-503	CLIP-seq
MIRT2431414	hsa-miR-519d	CLIP-seq
MIRT2431416	hsa-miR-539	CLIP-seq
MIRT2277479	hsa-miR-545	CLIP-seq
MIRT2431417	hsa-miR-548a-3p	CLIP-seq
MIRT2431419	hsa-miR-548ah	CLIP-seq
MIRT1168821	hsa-miR-548c-3p	CLIP-seq
MIRT2431421	hsa-miR-548e	CLIP-seq
MIRT2431422	hsa-miR-548f	CLIP-seq
MIRT2431424	hsa-miR-548o	CLIP-seq
MIRT2277480	hsa-miR-548p	CLIP-seq
MIRT1168822	hsa-miR-577	CLIP-seq
MIRT1168798	hsa-miR-590-3p	CLIP-seq
MIRT2277481	hsa-miR-646	CLIP-seq
MIRT2431434	hsa-miR-659	CLIP-seq
MIRT1168823	hsa-miR-7	CLIP-seq
MIRT2431437	hsa-miR-892a	CLIP-seq
MIRT1168801	hsa-miR-92a	CLIP-seq
MIRT1168802	hsa-miR-92b	CLIP-seq
MIRT2431439	hsa-miR-93	CLIP-seq
MIRT2277479	hsa-miR-545	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001725	Component	Stress fiber	IBA
GO:0001725	Component	Stress fiber	IDA	15020676
GO:0001725	Component	Stress fiber	IEA
GO:0003779	Function	Actin binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004687	Function	Myosin light chain kinase activity	IBA
GO:0004687	Function	Myosin light chain kinase activity	IDA	16284075
GO:0004687	Function	Myosin light chain kinase activity	IEA
GO:0004687	Function	Myosin light chain kinase activity	TAS	8575746
GO:0005515	Function	Protein binding	IPI	17474147, 25416956, 32296183, 35537812
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20053363
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006468	Process	Protein phosphorylation	TAS	8575746
GO:0006939	Process	Smooth muscle contraction	ISS
GO:0007517	Process	Muscle organ development	IEA
GO:0014820	Process	Tonic smooth muscle contraction	IBA
GO:0014820	Process	Tonic smooth muscle contraction	ISS
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	IDA	20053363
GO:0030027	Component	Lamellipodium	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	19826488
GO:0032060	Process	Bleb assembly	IMP	20181817
GO:0032154	Component	Cleavage furrow	IBA
GO:0032154	Component	Cleavage furrow	IDA	15020676
GO:0032154	Component	Cleavage furrow	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	16284075
GO:0060414	Process	Aorta smooth muscle tissue morphogenesis	IMP	21055718
GO:0071476	Process	Cellular hypotonic response	IDA	11976941
GO:0090303	Process	Positive regulation of wound healing	IDA	15825080
GO:0097110	Function	Scaffold protein binding	IPI	29496737
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA

MIM	HGNC	e!Ensembl
600922	7590	ENSG00000065534

Q15746

Protein name

Myosin light chain kinase, smooth muscle (MLCK) (smMLCK) (EC 2.7.11.18) (Kinase-related protein) (KRP) (Telokin) [Cleaved into: Myosin light chain kinase, smooth muscle, deglutamylated form]

Protein function

Calcium/calmodulin-dependent myosin light chain kinase implicated in smooth muscle contraction via phosphorylation of myosin light chains (MLC). Also regulates actin-myosin interaction through a non-kinase activity. Phosphorylates PTK2B/PYK2 and

PDB

2CQV , 2K0F , 2YR3 , 5JQA , 5JTH , 6C6M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	33 → 123	Immunoglobulin I-set domain	Domain
PF07679	I-set	161 → 250	Immunoglobulin I-set domain	Domain
PF16620	23ISL	251 → 412		Disordered
PF07679	I-set	414 → 504	Immunoglobulin I-set domain	Domain
PF07679	I-set	514 → 600	Immunoglobulin I-set domain	Domain
PF07679	I-set	623 → 712	Immunoglobulin I-set domain	Domain
PF07679	I-set	721 → 811	Immunoglobulin I-set domain	Domain
PF07679	I-set	1098 → 1187	Immunoglobulin I-set domain	Domain
PF07679	I-set	1238 → 1327	Immunoglobulin I-set domain	Domain
PF00041	fn3	1332 → 1416	Fibronectin type III domain	Domain
PF00069	Pkinase	1464 → 1719	Protein kinase domain	Domain
PF07679	I-set	1809 → 1899	Immunoglobulin I-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Smooth muscle and non-muscle isozymes are expressed in a wide variety of adult and fetal tissues and in cultured endothelium with qualitative expression appearing to be neither tissue- nor development-specific. Non-muscle isoform 2 is

Sequence

MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP
QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR
DSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT
TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE

Sequence length

1914

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Vascular smooth muscle contraction Apelin signaling pathway Focal adhesion Platelet activation Regulation of actin cytoskeleton Oxytocin signaling pathway Gastric acid secretion		Smooth Muscle Contraction RHO GTPases activate PAKs

3173

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Aortic aneurysm, familial thoracic 7	Likely pathogenic; Pathogenic	rs1237794394, rs2108273387, rs1047937861, rs2108006223, rs2108273583, rs2059058650, rs2107974888, rs2108578389, rs2108112355, rs2108340106, rs2474180246, rs2474176082, rs2473640876, rs886229659, rs1553781304 View all (18 more)	RCV001379261 RCV001380831 RCV001876664 RCV002036733 RCV001941678 RCV001911117 RCV001947252 RCV002035299 RCV001963882 RCV001945438 RCV002659694 RCV002843539 RCV002880225 RCV000515772 RCV000515767 RCV003525750 RCV003641330 RCV003641852 RCV003640440 RCV003873889 RCV000023044 RCV000023045 RCV000462848 RCV000551323 RCV000537895 RCV000648731 RCV000648714 RCV000648720 RCV000695043 RCV000855690 RCV001065860 RCV001236095 RCV001258091
Familial thoracic aortic aneurysm and aortic dissection	Likely pathogenic; Pathogenic	rs387906781, rs387906782, rs1553808296, rs1382893400	RCV000603875 RCV001798012 RCV000615028 RCV005682348
Isolated thoracic aortic aneurysm	Likely pathogenic	rs2108577268	RCV001374783
Megacystis, microcolon, hypoperistalsis syndrome	Pathogenic	rs1553787823	RCV001804175
Megacystis-microcolon-intestinal hypoperistalsis syndrome 1	Pathogenic	rs1553787619	RCV001804176
Visceral myopathy 1	Pathogenic	rs1553787823, rs1553787619	RCV000508615 RCV000508669

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Aortic aneurysm, familial abdominal, 1	Conflicting classifications of pathogenicity	rs202177283	RCV000157376
Aortic aneurysm, familial thoracic 6	Benign; Likely benign	rs3732485	RCV000211453
Atrial septal defect	Uncertain significance	rs368390254	RCV000582875
Cardiovascular phenotype	Benign; Likely benign; Uncertain significance	rs41431347, rs2059420069	RCV000620342 RCV005406004
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign; Likely benign	rs41443051	RCV005899563
Congenital aneurysm of ascending aorta	Conflicting classifications of pathogenicity; Uncertain significance	rs140148380, rs761892127	RCV001795472 RCV001796131
Connective tissue disorder	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs35912339, rs185681684, rs201835018, rs202229368, rs370153686, rs113491038, rs756560698, rs138777049, rs138172035, rs149530842, rs767877538, rs138877679, rs199988497, rs373584324, rs146990616 View all (22 more)	RCV000680576 RCV000659947 RCV000659933 RCV000680566 RCV000680569 RCV000680571 RCV000659934 RCV000680573 RCV000680564 RCV000659949 RCV000659931 RCV000659936 RCV000659940 RCV000659952 RCV000659951 RCV000659941 RCV000680575 RCV000680572 RCV000659942 RCV000659953 RCV000659950 RCV000659948 RCV000659946 RCV000659945 RCV000659944 RCV000659943 RCV000659939 RCV000659938 RCV000659937 RCV000659935 RCV000659932 RCV000680565 RCV000680567 RCV000680568 RCV000680570 RCV000680574 RCV000680577
Disproportionate tall stature	Conflicting classifications of pathogenicity; Uncertain significance	rs587782966, rs730880165	RCV000143929 RCV001837465
Familial aortic aneurysms	Conflicting classifications of pathogenicity	rs11558550	RCV000417348
Familial aortopathy	Conflicting classifications of pathogenicity	rs2474303339	RCV003994856
Familial cancer of breast	Benign; Conflicting classifications of pathogenicity	rs820329, rs373584324	RCV005894975 RCV005899564
Loeys-Dietz syndrome	Conflicting classifications of pathogenicity	rs730880164	RCV000157374
Lung cancer	Conflicting classifications of pathogenicity	rs113124819	RCV005894275
Marfan syndrome	Conflicting classifications of pathogenicity	rs201332554	RCV000581201
Megacystis-Microcolon Hypoperistalsis Syndrome 1	Conflicting classifications of pathogenicity	rs2474564027	RCV004801246
MYLK-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs772426809, rs149002594, rs751399308, rs143682943, rs149179973, rs367656778, rs557873884, rs140876214, rs559933360, rs750871704, rs750416997, rs369094329, rs371613462, rs534877967, rs746402430 View all (70 more)	RCV003898335 RCV003973244 RCV004751973 RCV003965875 RCV003921194 RCV003966227 RCV003416400 RCV004752026 RCV003394249 RCV004752051 RCV003892921 RCV004752069 RCV003968796 RCV003958496 RCV004750767 RCV003409998 RCV003955234 RCV003919882 RCV003891792 RCV003401186 RCV004751399 RCV003891978 RCV003977716 RCV003955403 RCV003930030 RCV003977714 RCV003955407 RCV003920017 RCV003909883 RCV003410514 RCV003408515 RCV003950198 RCV003932383 RCV003950201 RCV003932384 RCV003910347 RCV003950202 RCV003950199 RCV003922498 RCV003950200 RCV003909524 RCV003983496 RCV003904697 RCV003901482 RCV003959644 RCV003942488 RCV003409630 RCV004751539 RCV003401479 RCV003418191 RCV004730950 RCV003902702 RCV003925364 RCV003960091 RCV003962411 RCV004751575 RCV003945285 RCV004751595 RCV004751596 RCV003962557 RCV003905420 RCV003960363 RCV003960362 RCV004751631 RCV003935657 RCV003905591 RCV004751628 RCV003905605 RCV003917947 RCV003935675 RCV003965303 RCV004751636 RCV003965378 RCV003918057 RCV004751644 RCV004751643 RCV003983160 RCV003980305 RCV003983167 RCV004751739 RCV003938232 RCV003948123 RCV003892826 RCV003948152 RCV003897976
Ovarian serous cystadenocarcinoma	Uncertain significance; Likely benign	rs758272545, rs368116696, rs139868162	RCV005920925 RCV005928195 RCV005913870
Prostate cancer	Uncertain significance	rs193921083	RCV000149329
Sarcoma	Uncertain significance	rs368390254	RCV005901641
See cases	Conflicting classifications of pathogenicity	rs770373926	RCV002252570
Squamous cell carcinoma of the head and neck	Likely benign	rs748128807	RCV005932702
Uterine carcinosarcoma	Benign	rs820329	RCV005894976
Uterine corpus endometrial carcinoma	Conflicting classifications of pathogenicity	rs377231739	RCV005895389

Show/Hide Text Mining Associations (94)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	27538918
Acute Lung Injury	Associate	16399953, 16877634, 26111161
Adenocarcinoma of Lung	Associate	25292047
Adie Syndrome	Associate	24889065
Alzheimer Disease	Associate	33083483
Aneurysm	Associate	29544503
Aortic Aneurysm Abdominal	Associate	11436088, 34852854
Aortic Aneurysm Familial Abdominal 1	Inhibit	11436088
Aortic Aneurysm Familial Thoracic 1	Associate	27586135, 29510914
Aortic Aneurysm Thoracic	Associate	26017485, 26854089
Aortic Diseases	Associate	27586135, 29925964
Aortic Dissection	Associate	27586135, 28855619, 29544503, 29925964, 33083483, 35078481
Asthma	Associate	18521921, 19277499, 26111161
Atherosclerosis	Associate	17357071
Breast Neoplasms	Associate	20453870, 26334100, 33800915
Calcinosis Cutis	Associate	27662660
Carcinoma Hepatocellular	Associate	33168027, 33232580, 33466191
Carcinoma Non Small Cell Lung	Associate	15970650, 25179839
Cerebral Small Vessel Diseases	Associate	22621687
Cholestasis	Associate	28369585
Cholestasis Intrahepatic	Associate	27538918
Colorectal Neoplasms	Associate	26320459, 30161129
Connective Tissue Diseases	Associate	33125268
Coronary Artery Disease	Associate	17357071, 19706030
Coronary Artery Dissection Spontaneous	Associate	33125268
Crisponi syndrome	Associate	27483374
Dermatitis Atopic 3	Associate	19277499
Diabetes Mellitus	Associate	22621687, 29955616, 35628588
Diarrhea	Stimulate	27869798
Dissection Thoracic Aorta	Associate	27586135
Drug Related Side Effects and Adverse Reactions	Associate	36971786
Edema	Associate	38013282
Endometrial Neoplasms	Inhibit	31795319
Endometriosis	Associate	37326118
Enterocolitis Necrotizing	Stimulate	27720222
Esophageal Motility Disorders	Associate	28602422
Familial Primary Pulmonary Hypertension	Associate	36007983
Gastrointestinal Diseases	Associate	29052298
Gastrointestinal Stromal Tumors	Associate	36971786
Gastroparesis	Inhibit	29052298
Genetic Diseases Inborn	Associate	29907982
Glaucoma	Associate	20375339
Heart Diseases	Associate	15681825, 16402035, 27884156, 35078481
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22759382, 35893033
Hyper IgM Immunodeficiency X Linked with Ectodermal Dysplasia Hypohidrotic	Associate	27543902
Hyperlipidemias	Associate	22621687
Hypertrophy	Associate	24722483
Hypoxia	Associate	35378949
Inflammation	Associate	16399953, 16474009, 21667320, 26111161, 38013282, 38050320
Inflammatory Bowel Diseases	Stimulate	16402035
Inflammatory Bowel Diseases	Associate	22135309
Intestinal Pseudo Obstruction	Associate	33986007
Intracranial Aneurysm	Associate	24615040
Intracranial Hypertension	Stimulate	18613964
Irritable Bowel Syndrome	Associate	27869798
Irritable Bowel Syndrome	Inhibit	33843785
Job Syndrome	Associate	35563154
Lateral meningocele syndrome	Associate	21412072
Leiomyosarcoma	Associate	19901961, 28893210
Lung Diseases	Associate	26111161, 30161129
Lymphatic Metastasis	Associate	22377736
Megacystis microcolon intestinal hypoperistalsis syndrome	Associate	28602422, 33031641
Multiple Sclerosis	Associate	21346779
Muscular Atrophy	Associate	27483374
Muscular Diseases	Associate	29453416, 31427716
Myalgia	Associate	27483374
Necrosis	Associate	38013282, 38050320
Neoplasm Metastasis	Associate	15970650, 19826488, 32657779, 35278271
Neoplasm Metastasis	Inhibit	33168027
Neoplasms	Associate	15970650, 19826488, 20498637, 22377736, 22759382, 24224004, 24889065, 26334100, 31427478, 33168027, 35799671, 36971786, 38013282
Neoplasms	Inhibit	25179839
Optic Nerve Hypoplasia	Associate	20375339
Osteoporosis	Associate	33800915
Osteosarcoma	Associate	38050320
Ovarian Neoplasms	Associate	32495861, 35278271
Paraplegia	Associate	27483374
Polycythemia Vera	Associate	39511342
Precancerous Conditions	Associate	22377736
Prostatic Neoplasms	Stimulate	29798970
Prostatic Neoplasms	Associate	34860853, 35799671
Pyruvate Carboxylase Deficiency Disease	Associate	29798970
Respiratory Distress Syndrome	Associate	27543902
Ring Chromosome 20 Syndrome	Associate	35378949
Sarcoma	Associate	30459475
Sepsis	Associate	16399953
Squamous Cell Carcinoma of Head and Neck	Associate	31427478
Status Asthmaticus	Associate	19277499
Stomach Neoplasms	Associate	22377736
Thoracic Diseases	Associate	29925964, 36007983
Ureteral Obstruction	Associate	38013282
Urinary Bladder Diseases	Associate	38050320
Urinary Bladder Neoplasms	Associate	36245371, 36472061, 38013282, 38050320, 38422408
Varicose Veins	Associate	24183353
Wounds and Injuries	Associate	35378949

MYLK (myosin light chain kinase)