Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4635
Gene name Gene Name - the full gene name approved by the HGNC.
Myosin light chain 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYL4
Synonyms (NCBI Gene) Gene synonyms aliases
ALC1, AMLC, GT1, PRO1957
Disease Acronyms (UniProt) Disease acronyms from UniProt database
GT1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs886037778 G>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT2685643 hsa-miR-3152-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction IMP 16675844
GO:0003785 Function Actin monomer binding IDA 9180271
GO:0005509 Function Calcium ion binding IEA
GO:0005829 Component Cytosol TAS
GO:0016459 Component Myosin complex IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
160770 7585 ENSG00000198336
Protein
UniProt ID P12829
Protein name Myosin light chain 4 (Myosin light chain 1, embryonic muscle/atrial isoform) (Myosin light chain alkali GT-1 isoform)
Protein function Regulatory light chain of myosin. Does not bind calcium.
Family and domains
Sequence
MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAF
SLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL
QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQED
ANGCINYEAFVKHIMSG
Sequence length 197
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Motor proteins
Cytoskeleton in muscle cells
  Striated Muscle Contraction
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation ATRIAL FIBRILLATION, FAMILIAL, 1 (disorder), ATRIAL FIBRILLATION, FAMILIAL, 18, Familial atrial fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
27066836
Hypertrophic cardiomyopathy Hypertrophic Cardiomyopathy, Hypertrophic obstructive cardiomyopathy rs63750743, rs104894655, rs121908987, rs587776643, rs28938173, rs121908989, rs121908991, rs267606977, rs267606978, rs193922384, rs121909374, rs886041030, rs886041031, rs121909375, rs121909377
View all (752 more)
9527842
Unknown
Disease term Disease name Evidence References Source
Atrial Fibrillation familial atrial fibrillation, atrial fibrillation, familial, 18 GenCC
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 23535507
Aortic Valve Insufficiency Stimulate 1533180
Aortic Valve Stenosis Stimulate 1533180
Atrial Fibrillation Associate 29050564, 31406021, 35874900
Cardiomyopathies Associate 31406021
Cardiomyopathy Hypertrophic Associate 31481666
Cardiomyopathy Hypertrophic Familial Associate 1533180
Colorectal Neoplasms Associate 9748578
Double Outlet Right Ventricle Associate 8755658
Heart Defects Congenital Associate 8755658