Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4633
Gene name Gene Name - the full gene name approved by the HGNC.
Myosin light chain 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYL2
Synonyms (NCBI Gene) Gene synonyms aliases
CMH10, MFM12, MLC-2, MLC-2s/v, MLC-2v, MLC2
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.11
Summary Summary of gene provided in NCBI Entrez Gene.
Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventr
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894363 C>T Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity, benign, likely-pathogenic Coding sequence variant, missense variant
rs104894368 C>A,G,T Pathogenic-likely-pathogenic, pathogenic, uncertain-significance Coding sequence variant, stop gained, missense variant
rs104894369 C>A,T Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs104894370 A>G Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs111373423 A>G Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048671 hsa-miR-99a-5p CLASH 23622248
MIRT736741 hsa-miR-124-3p qRT-PCR 32727232
MIRT1168601 hsa-miR-3675-5p CLIP-seq
MIRT1168602 hsa-miR-4691-3p CLIP-seq
MIRT1168603 hsa-miR-4694-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction ISS
GO:0003007 Process Heart morphogenesis IEA
GO:0003785 Function Actin monomer binding IDA 9180271
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 11102452
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
160781 7583 ENSG00000111245
Protein
UniProt ID P10916
Protein name Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MLC-2) (MLC-2v) (Cardiac myosin light chain 2) (Myosin light chain 2, slow skeletal/ventricular muscle isoform) (MLC-2s/v) (Ventricular myosin light chain 2)
Protein function Contractile protein that plays a role in heart development and function (PubMed:23365102, PubMed:32453731). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm st
PDB 5TBY , 8ACT , 8G4L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 28 56 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in type I muscle fibers. {ECO:0000269|PubMed:23365102, ECO:0000269|PubMed:32453731}.
Sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Sequence length 166
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Motor proteins
Cytoskeleton in muscle cells
Shigellosis
Salmonella infection
Hypertrophic cardiomyopathy
Dilated cardiomyopathy
  Striated Muscle Contraction
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
cardiomyopathy Cardiomyopathy rs397516406, rs104894368, rs104894369, rs1592798444, rs104894370 N/A
Hypertrophic Cardiomyopathy Hypertrophic cardiomyopathy 10, Primary familial hypertrophic cardiomyopathy rs199474815, rs104894368, rs587782965, rs104894369, rs104894370, rs727504425 N/A
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy rs397516406, rs104894368, rs587782965, rs104894369, rs727503296, rs104894370 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
arrhythmogenic right ventricular cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy N/A N/A ClinVar
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Congenital Heart Disease congenital heart disease N/A N/A ClinVar
congenital myopathy with fiber type disproportion Congenital myopathy with fiber type disproportion N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 18948272
Cardiomyopathies Associate 22194935, 31127036, 35544052, 37967257
Cardiomyopathy Dilated Stimulate 11812662
Cardiomyopathy Dilated Associate 30690923
Cardiomyopathy Dilated with Left Ventricular Noncompaction Associate 30690923
Cardiomyopathy Hypertrophic Associate 16199542, 18411228, 21259275, 21896538, 22429680, 22857948, 25086479, 25342278, 27483260, 27841901, 28223422, 28771489, 29709087, 30681346, 30775854
View all (4 more)
Cardiomyopathy Hypertrophic Familial Associate 22112859
Cardiomyopathy Restrictive Associate 21823217
Chagas Disease Associate 22543060
Colorectal Neoplasms Associate 30846413