Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4618
Gene name Gene Name - the full gene name approved by the HGNC.
Myogenic factor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYF6
Synonyms (NCBI Gene) Gene synonyms aliases
CNM3, MRF4, bHLHc4, myf-6
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q21.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021325 hsa-miR-9-5p Microarray 17612493
MIRT1168089 hsa-miR-3163 CLIP-seq
MIRT1168090 hsa-miR-548aa CLIP-seq
MIRT1168091 hsa-miR-548n CLIP-seq
MIRT1168092 hsa-miR-548t CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
159991 7566 ENSG00000111046
Protein
UniProt ID P23409
Protein name Myogenic factor 6 (Myf-6) (Class C basic helix-loop-helix protein 4) (bHLHc4) (Muscle-specific regulatory factor 4)
Protein function Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01586 Basic 3 93 Myogenic Basic domain Family
PF00010 HLH 94 145 Helix-loop-helix DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Skeletal muscle.
Sequence
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTD
RRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAISYIERLQ
DLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
RTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVV
EK
Sequence length 242
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Myogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Centronuclear Myopathy autosomal dominant centronuclear myopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cryopyrin Associated Periodic Syndromes Associate 37380094
Leiomyosarcoma Associate 28884746
Leukemia Hairy Cell Associate 32040482
Leukemia Lymphocytic Chronic B Cell Associate 32040482
Lung Neoplasms Associate 31526458
Lymphoma Mantle Cell Associate 32040482
Myasthenic Syndromes Congenital Associate 27286495
Myotonic Dystrophy Associate 27286495
Neoplasms Associate 1764365
Pulmonary Disease Chronic Obstructive Inhibit 24666540