Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4615
Gene name	MYD88 innate immune signal transduction adaptor
Gene symbol	MYD88
Synonyms (NCBI Gene)	IMD68MYD88DWM1
Chromosome	3
Chromosome location	3p22.2
Summary	This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853064	C>A,G,T	Pathogenic	Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs387907272	T>C	Likely-pathogenic, uncertain-significance, pathogenic	Stop lost, missense variant, coding sequence variant, terminator codon variant, non coding transcript variant

297

Show/Hide all (297)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007368	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	23522925
MIRT007368	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	23522925
MIRT020533	hsa-miR-155-5p	Western blot	21030878
MIRT054356	hsa-miR-21-5p	ChipELISAFlow cytometryLuciferase reporter assayQRTPCRWestern blot	23633945
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT527507	hsa-miR-5690	PAR-CLIP	22012620
MIRT237424	hsa-miR-6817-3p	PAR-CLIP	22012620
MIRT527506	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527505	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT527504	hsa-miR-3685	PAR-CLIP	22012620
MIRT527503	hsa-miR-384	PAR-CLIP	22012620
MIRT438020	hsa-miR-149-5p	Luciferase reporter assayWestern blottingqRT-PCR	31855318
MIRT735107	hsa-miR-124-3p	Western blottingImmunohistochemistry (IHC)	32850781
MIRT735382	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT736264	hsa-miR-30a-3p	Luciferase reporter assayWestern blottingImmunofluorescence	31958204
MIRT736431	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT527505	hsa-miR-155-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)ImmunofluorescenceqRT-PCR	32031337
MIRT527507	hsa-miR-5690	PAR-CLIP	22012620
MIRT237424	hsa-miR-6817-3p	PAR-CLIP	22012620
MIRT527506	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527505	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT527504	hsa-miR-3685	PAR-CLIP	22012620
MIRT527503	hsa-miR-384	PAR-CLIP	22012620
MIRT755407	hsa-miR-505-5p	Luciferase reporter assayWestern blottingqRT-PCR	35959879
MIRT735382	hsa-miR-146a-5p	Western blotting	36210830
MIRT1167937	hsa-miR-1224-3p	CLIP-seq
MIRT1167938	hsa-miR-1260	CLIP-seq
MIRT1167939	hsa-miR-1260b	CLIP-seq
MIRT1167940	hsa-miR-1280	CLIP-seq
MIRT1167941	hsa-miR-1286	CLIP-seq
MIRT1167942	hsa-miR-155	CLIP-seq
MIRT1167943	hsa-miR-188-3p	CLIP-seq
MIRT1167944	hsa-miR-198	CLIP-seq
MIRT1167945	hsa-miR-203	CLIP-seq
MIRT1167946	hsa-miR-2278	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT1167948	hsa-miR-2964a-5p	CLIP-seq
MIRT1167949	hsa-miR-3119	CLIP-seq
MIRT1167950	hsa-miR-3156-3p	CLIP-seq
MIRT1167951	hsa-miR-3199	CLIP-seq
MIRT1167952	hsa-miR-3611	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT1167955	hsa-miR-3925-3p	CLIP-seq
MIRT1167956	hsa-miR-4252	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167958	hsa-miR-4276	CLIP-seq
MIRT1167959	hsa-miR-4330	CLIP-seq
MIRT1167960	hsa-miR-4436a	CLIP-seq
MIRT1167961	hsa-miR-4461	CLIP-seq
MIRT1167962	hsa-miR-4469	CLIP-seq
MIRT1167963	hsa-miR-4470	CLIP-seq
MIRT1167964	hsa-miR-4476	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT1167966	hsa-miR-4642	CLIP-seq
MIRT1167967	hsa-miR-4666-5p	CLIP-seq
MIRT1167968	hsa-miR-4670-3p	CLIP-seq
MIRT1167969	hsa-miR-4691-5p	CLIP-seq
MIRT1167970	hsa-miR-4693-3p	CLIP-seq
MIRT1167971	hsa-miR-4696	CLIP-seq
MIRT1167972	hsa-miR-4715-5p	CLIP-seq
MIRT1167973	hsa-miR-4722-5p	CLIP-seq
MIRT1167974	hsa-miR-4732-5p	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT1167977	hsa-miR-562	CLIP-seq
MIRT1167978	hsa-miR-654-3p	CLIP-seq
MIRT1167979	hsa-miR-665	CLIP-seq
MIRT1167980	hsa-miR-766	CLIP-seq
MIRT1167981	hsa-miR-944	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167981	hsa-miR-944	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT1167941	hsa-miR-1286	CLIP-seq
MIRT2277302	hsa-miR-1343	CLIP-seq
MIRT1167944	hsa-miR-198	CLIP-seq
MIRT1167945	hsa-miR-203	CLIP-seq
MIRT1167948	hsa-miR-2964a-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2277305	hsa-miR-3166	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT1167955	hsa-miR-3925-3p	CLIP-seq
MIRT2277308	hsa-miR-3977	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167960	hsa-miR-4436a	CLIP-seq
MIRT1167961	hsa-miR-4461	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT1167973	hsa-miR-4722-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2277312	hsa-miR-4771	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT1167977	hsa-miR-562	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT1167979	hsa-miR-665	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT1167980	hsa-miR-766	CLIP-seq
MIRT2576146	hsa-miR-1184	CLIP-seq
MIRT2576147	hsa-miR-1205	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT2576148	hsa-miR-1245b-3p	CLIP-seq
MIRT2576149	hsa-miR-140-3p	CLIP-seq
MIRT2576150	hsa-miR-147	CLIP-seq
MIRT2576151	hsa-miR-183	CLIP-seq
MIRT2576152	hsa-miR-185	CLIP-seq
MIRT2576153	hsa-miR-188-5p	CLIP-seq
MIRT2576154	hsa-miR-2110	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2576155	hsa-miR-302f	CLIP-seq
MIRT2576156	hsa-miR-3144-5p	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2576157	hsa-miR-3150a-3p	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2576158	hsa-miR-3160-3p	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2576159	hsa-miR-3189-3p	CLIP-seq
MIRT2576160	hsa-miR-3191	CLIP-seq
MIRT2576161	hsa-miR-3192	CLIP-seq
MIRT2576162	hsa-miR-3194-3p	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT2576163	hsa-miR-326	CLIP-seq
MIRT2576164	hsa-miR-330-5p	CLIP-seq
MIRT2576165	hsa-miR-346	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT2576166	hsa-miR-3667-5p	CLIP-seq
MIRT2576167	hsa-miR-3689a-3p	CLIP-seq
MIRT2576168	hsa-miR-3689c	CLIP-seq
MIRT2576169	hsa-miR-3689d	CLIP-seq
MIRT2576170	hsa-miR-3925-5p	CLIP-seq
MIRT2576171	hsa-miR-3937	CLIP-seq
MIRT2576172	hsa-miR-4288	CLIP-seq
MIRT2576173	hsa-miR-4289	CLIP-seq
MIRT2576174	hsa-miR-4293	CLIP-seq
MIRT2576175	hsa-miR-4306	CLIP-seq
MIRT2576176	hsa-miR-4314	CLIP-seq
MIRT2576177	hsa-miR-4419a	CLIP-seq
MIRT2576178	hsa-miR-4428	CLIP-seq
MIRT2576179	hsa-miR-4496	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2576180	hsa-miR-4510	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT2576181	hsa-miR-4533	CLIP-seq
MIRT2576182	hsa-miR-4633-3p	CLIP-seq
MIRT2576183	hsa-miR-4644	CLIP-seq
MIRT2576184	hsa-miR-4646-5p	CLIP-seq
MIRT2576185	hsa-miR-4652-5p	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT2576186	hsa-miR-4661-3p	CLIP-seq
MIRT2576187	hsa-miR-4690-3p	CLIP-seq
MIRT2576188	hsa-miR-4711-3p	CLIP-seq
MIRT2576189	hsa-miR-4712-3p	CLIP-seq
MIRT2576190	hsa-miR-4713-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2576191	hsa-miR-4728-5p	CLIP-seq
MIRT2576192	hsa-miR-4747-5p	CLIP-seq
MIRT2576193	hsa-miR-4755-3p	CLIP-seq
MIRT2576194	hsa-miR-4761-5p	CLIP-seq
MIRT2576195	hsa-miR-4773	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT2576196	hsa-miR-4800-5p	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT2576197	hsa-miR-544b	CLIP-seq
MIRT2576198	hsa-miR-548a-5p	CLIP-seq
MIRT2576199	hsa-miR-548ab	CLIP-seq
MIRT2576200	hsa-miR-548ak	CLIP-seq
MIRT2576201	hsa-miR-548b-5p	CLIP-seq
MIRT2576202	hsa-miR-548c-5p	CLIP-seq
MIRT2576203	hsa-miR-548d-5p	CLIP-seq
MIRT2576204	hsa-miR-548h	CLIP-seq
MIRT2576205	hsa-miR-548i	CLIP-seq
MIRT2576206	hsa-miR-548j	CLIP-seq
MIRT2576207	hsa-miR-548k	CLIP-seq
MIRT2576208	hsa-miR-548l	CLIP-seq
MIRT2576209	hsa-miR-548w	CLIP-seq
MIRT2576210	hsa-miR-548y	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT2576211	hsa-miR-559	CLIP-seq
MIRT2576212	hsa-miR-591	CLIP-seq
MIRT2576213	hsa-miR-615-5p	CLIP-seq
MIRT2576214	hsa-miR-632	CLIP-seq
MIRT2576215	hsa-miR-635	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT2576216	hsa-miR-660	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT2576217	hsa-miR-711	CLIP-seq
MIRT2576218	hsa-miR-767-3p	CLIP-seq
MIRT2576146	hsa-miR-1184	CLIP-seq
MIRT2576147	hsa-miR-1205	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT2576148	hsa-miR-1245b-3p	CLIP-seq
MIRT2576149	hsa-miR-140-3p	CLIP-seq
MIRT2576150	hsa-miR-147	CLIP-seq
MIRT2685626	hsa-miR-1587	CLIP-seq
MIRT2576151	hsa-miR-183	CLIP-seq
MIRT2576152	hsa-miR-185	CLIP-seq
MIRT2576153	hsa-miR-188-5p	CLIP-seq
MIRT2576154	hsa-miR-2110	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2576155	hsa-miR-302f	CLIP-seq
MIRT2576156	hsa-miR-3144-5p	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2576157	hsa-miR-3150a-3p	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2576158	hsa-miR-3160-3p	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2576159	hsa-miR-3189-3p	CLIP-seq
MIRT2576160	hsa-miR-3191	CLIP-seq
MIRT2576161	hsa-miR-3192	CLIP-seq
MIRT2576162	hsa-miR-3194-3p	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT2576163	hsa-miR-326	CLIP-seq
MIRT2576164	hsa-miR-330-5p	CLIP-seq
MIRT2576165	hsa-miR-346	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT2576166	hsa-miR-3667-5p	CLIP-seq
MIRT2576167	hsa-miR-3689a-3p	CLIP-seq
MIRT2576168	hsa-miR-3689c	CLIP-seq
MIRT2576169	hsa-miR-3689d	CLIP-seq
MIRT2576170	hsa-miR-3925-5p	CLIP-seq
MIRT2576171	hsa-miR-3937	CLIP-seq
MIRT2576172	hsa-miR-4288	CLIP-seq
MIRT2576173	hsa-miR-4289	CLIP-seq
MIRT2576174	hsa-miR-4293	CLIP-seq
MIRT2576175	hsa-miR-4306	CLIP-seq
MIRT2576176	hsa-miR-4314	CLIP-seq
MIRT2576177	hsa-miR-4419a	CLIP-seq
MIRT2576178	hsa-miR-4428	CLIP-seq
MIRT2685627	hsa-miR-4492	CLIP-seq
MIRT2576179	hsa-miR-4496	CLIP-seq
MIRT2685628	hsa-miR-4498	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2685629	hsa-miR-4505	CLIP-seq
MIRT2576180	hsa-miR-4510	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT2576181	hsa-miR-4533	CLIP-seq
MIRT2576182	hsa-miR-4633-3p	CLIP-seq
MIRT2685630	hsa-miR-4640-5p	CLIP-seq
MIRT2576183	hsa-miR-4644	CLIP-seq
MIRT2576184	hsa-miR-4646-5p	CLIP-seq
MIRT2576185	hsa-miR-4652-5p	CLIP-seq
MIRT2685631	hsa-miR-4656	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT2576186	hsa-miR-4661-3p	CLIP-seq
MIRT2685632	hsa-miR-4674	CLIP-seq
MIRT2685633	hsa-miR-4675	CLIP-seq
MIRT2576187	hsa-miR-4690-3p	CLIP-seq
MIRT2576188	hsa-miR-4711-3p	CLIP-seq
MIRT2576189	hsa-miR-4712-3p	CLIP-seq
MIRT2576190	hsa-miR-4713-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2685634	hsa-miR-4726-5p	CLIP-seq
MIRT2576191	hsa-miR-4728-5p	CLIP-seq
MIRT2685635	hsa-miR-4741	CLIP-seq
MIRT2576192	hsa-miR-4747-5p	CLIP-seq
MIRT2576193	hsa-miR-4755-3p	CLIP-seq
MIRT2576194	hsa-miR-4761-5p	CLIP-seq
MIRT2576195	hsa-miR-4773	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT2576196	hsa-miR-4800-5p	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT2576197	hsa-miR-544b	CLIP-seq
MIRT2576198	hsa-miR-548a-5p	CLIP-seq
MIRT2576199	hsa-miR-548ab	CLIP-seq
MIRT2576200	hsa-miR-548ak	CLIP-seq
MIRT2576201	hsa-miR-548b-5p	CLIP-seq
MIRT2576202	hsa-miR-548c-5p	CLIP-seq
MIRT2576203	hsa-miR-548d-5p	CLIP-seq
MIRT2576204	hsa-miR-548h	CLIP-seq
MIRT2576205	hsa-miR-548i	CLIP-seq
MIRT2576206	hsa-miR-548j	CLIP-seq
MIRT2576207	hsa-miR-548k	CLIP-seq
MIRT2576208	hsa-miR-548l	CLIP-seq
MIRT2576209	hsa-miR-548w	CLIP-seq
MIRT2576210	hsa-miR-548y	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT2576211	hsa-miR-559	CLIP-seq
MIRT2576212	hsa-miR-591	CLIP-seq
MIRT2576213	hsa-miR-615-5p	CLIP-seq
MIRT2576214	hsa-miR-632	CLIP-seq
MIRT2576215	hsa-miR-635	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT2576216	hsa-miR-660	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT2576217	hsa-miR-711	CLIP-seq
MIRT2685636	hsa-miR-762	CLIP-seq
MIRT2576218	hsa-miR-767-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
STAT3	Unknown	12244150

134

Show/Hide all (134)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002238	Process	Response to molecule of fungal origin	IEA
GO:0002269	Process	Leukocyte activation involved in inflammatory response	IEA
GO:0002283	Process	Neutrophil activation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005121	Function	Toll binding	IEA
GO:0005123	Function	Death receptor binding	TAS	9374458
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	10880445, 11544529, 12860405, 15728506, 16189514, 16293622, 16365431, 17126326, 17258210, 17567694, 17583698, 19948740, 20485341, 20676093, 20696886, 21334391, 21829704, 21988832, 22155231, 22581261, 23143332, 24316379, 25416956, 25502805, 25910212, 26592460, 26752465, 26871637, 285
GO:0005634	Component	Nucleus	IDA	22155231
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	9430229
GO:0005737	Component	Cytoplasm	IDA	22155231
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16751103
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IMP	30883606
GO:0006915	Process	Apoptotic process	IMP	22155231
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	NAS	9013863
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9374458
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	IEA
GO:0008063	Process	Toll signaling pathway	IBA
GO:0008063	Process	Toll signaling pathway	IEA
GO:0009615	Process	Response to virus	IEA
GO:0009682	Process	Induced systemic resistance	IEA
GO:0009986	Component	Cell surface	IDA	22851693
GO:0010008	Component	Endosome membrane	TAS
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0014004	Process	Microglia differentiation	IEA
GO:0014075	Process	Response to amine	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019897	Component	Extrinsic component of plasma membrane	IDA	9430229
GO:0022008	Process	Neurogenesis	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	16751103
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IMP	23633945
GO:0032494	Process	Response to peptidoglycan	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032675	Process	Regulation of interleukin-6 production	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	33718825
GO:0032740	Process	Positive regulation of interleukin-17 production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0032747	Process	Positive regulation of interleukin-23 production	IEA
GO:0032747	Process	Positive regulation of interleukin-23 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	20219467
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IC	35977521
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	7479976, 17878161, 25355951, 25371197, 26189595
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	16751103
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IDA	19289601
GO:0034146	Process	Toll-like receptor 5 signaling pathway	IDA	16751103
GO:0034158	Process	Toll-like receptor 8 signaling pathway	IDA	33718825
GO:0035325	Function	Toll-like receptor binding	IBA
GO:0035325	Function	Toll-like receptor binding	IEA
GO:0035591	Function	Signaling adaptor activity	IDA	16751103
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	12048232, 26189595
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	IDA	27708357
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	IDA	36964784
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	11960013, 20532808
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	18802081
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042742	Process	Defense response to bacterium	IMP	20219467
GO:0042802	Function	Identical protein binding	IPI	11544529, 17258210, 21516116, 21988832, 22155231, 25416956, 25910212, 27107012, 29892012, 32296183
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043200	Process	Response to amino acid	IEA
GO:0043588	Process	Skin development	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	22155231
GO:0051607	Process	Defense response to virus	IDA	33718825
GO:0051607	Process	Defense response to virus	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	9430229, 9734363, 16751103
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	23633945
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	14625308, 20485341
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	9430229
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA
GO:0070555	Process	Response to interleukin-1	IMP	19281832
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	15294994
GO:0070944	Process	Neutrophil-mediated killing of bacterium	IEA
GO:0070976	Function	TIR domain binding	IEA
GO:0070976	Function	TIR domain binding	IPI	19509286
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0090557	Process	Establishment of endothelial intestinal barrier	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS
GO:0140674	Function	ATP-dependent histone chaperone activity	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IMP	20219467
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IMP	33718825
GO:1902622	Process	Regulation of neutrophil migration	IEA
GO:2000338	Process	Regulation of chemokine (C-X-C motif) ligand 1 production	IEA
GO:2000341	Process	Regulation of chemokine (C-X-C motif) ligand 2 production	IEA

MIM	HGNC	e!Ensembl
602170	7562	ENSG00000172936

Q99836

Protein name

Myeloid differentiation primary response protein MyD88

Protein function

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed:15361868, PubMed:18292575, PubMed:33718825, PubMed:37971847). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa

PDB

2JS7 , 2Z5V , 3MOP , 4DOM , 4EO7 , 6I3N , 7BEQ , 7BER , 7L6W , 8S78 , 8W8M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00531	Death	30 → 107	Death domain	Domain
PF01582	TIR	163 → 295	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:8957090}.

Sequence

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE
IRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Sequence length

296

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway NF-kappa B signaling pathway Toll-like receptor signaling pathway NOD-like receptor signaling pathway Alcoholic liver disease Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Legionellosis Yersinia infection Leishmaniasis Chagas disease African trypanosomiasis Malaria Toxoplasmosis Tuberculosis Hepatitis B Measles Influenza A Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis		ER-Phagosome pathway PIP3 activates AKT signaling MyD88:MAL(TIRAP) cascade initiated on plasma membrane RIP-mediated NFkB activation via ZBP1 p75NTR recruits signalling complexes DEx/H-box helicases activate type I IFN and inflammatory cytokines production MyD88 deficiency (TLR2/4) MyD88 deficiency (TLR5) IRAK4 deficiency (TLR5) IRAK4 deficiency (TLR2/4) PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Interleukin-1 signaling TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation MyD88 dependent cascade initiated on endosome MyD88 cascade initiated on plasma membrane

144

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Pyogenic bacterial infections due to MyD88 deficiency	Pathogenic; Likely pathogenic	rs765198848, rs2125777824, rs2471593660, rs137853065, rs878852993	RCV001784687 RCV002016128 RCV003066168 RCV000007925 RCV000007923

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Macroglobulinemia, Waldenstrom, somatic	Uncertain significance	rs387907272	RCV000030709
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	rs387907272	RCV003315524
MYD88-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	rs201871349, rs564488349, rs746651350, rs79867863, rs143752366	RCV003952611 RCV003943815 RCV003942820 RCV003905746 RCV003967990
Neoplasm	Uncertain significance	rs387907272	RCV004668744

Show/Hide Text Mining Associations (203)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aggressive Periodontitis	Associate	28883894
Alcoholism	Associate	34415075
Anemia Hemolytic Autoimmune	Associate	25819228
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	37137530
Arthralgia	Associate	28381754
Arthritis Rheumatoid	Associate	17255320, 31320744, 36405992, 36614150, 37749630
Asthma	Stimulate	35190755
Asthma	Associate	37717070, 38367422
Atherosclerosis	Associate	34020127, 36733418
Atrial Fibrillation	Associate	29595637
Autoimmune Diseases	Associate	26794091
Bacterial Infections	Associate	18591412, 21057262, 29269280, 30837984, 31301515
BCG Infection Generalized Familial	Associate	31301515
Bone Marrow Diseases	Associate	24553177, 25216226, 27301862, 28983055, 35877223, 36210485
Brachydactyly Type D	Stimulate	28504607
Breast Neoplasms	Associate	25360699, 26261595, 26299331, 30015868, 30066873, 30157918, 35102665
Bronchopneumonia	Associate	33719773
Bulimia	Associate	25160558
Cancer Pain	Associate	26332828
Candidiasis	Associate	26700889
Carcinogenesis	Associate	23569218, 35910766
Carcinoma Embryonal	Inhibit	24977712
Carcinoma Hepatocellular	Associate	26985932, 34435646, 36793272
Carcinoma Non Small Cell Lung	Associate	26600481, 31432177
Carcinoma Ovarian Epithelial	Associate	17940625, 19619321, 22533866, 22985132, 24452475, 24977712, 27118139, 27460076, 27708225, 29502561
Carcinoma Pancreatic Ductal	Associate	25766528
Carcinoma Squamous Cell	Associate	33637109
Cardiomyopathy Hypertrophic Familial	Associate	35609334
Central Nervous System Diseases	Associate	37997571
Central Nervous System Infections	Associate	37678673
Central Nervous System Neoplasms	Associate	30353605
Chronic Disease	Associate	33637950
Cognition Disorders	Associate	26332828
Colitis Microscopic	Associate	27672296
Colorectal Neoplasms	Associate	20145615, 30239551, 31659096, 34626022
Common Variable Immunodeficiency	Associate	29757592
Congenital thrombotic disease due to Protein C deficiency	Associate	37951851
Corneal Endothelial Cell Loss	Associate	34369659
Coronary Artery Disease	Associate	26959040
COVID 19	Associate	33637950, 34020127, 36496170, 36498845, 37310504, 37365052
Critical Illness	Associate	37567916
Cryoglobulinemia Familial Mixed	Associate	36845129
Cystic Fibrosis	Associate	15661927
Cytokine Release Syndrome	Associate	29410345
Death	Associate	24553177, 31276195, 36429083
Demyelinating Diseases	Associate	35577568, 35798560
Depressive Disorder	Associate	36496170
Depressive Disorder Major	Associate	36496170
Diabetes Gestational	Associate	27340831, 33019392
Diabetes Mellitus	Associate	35504843
Diabetes Mellitus Type 1	Associate	32273829
Diabetes Mellitus Type 2	Associate	20067962
Diarrhea	Associate	28381754
Disease	Associate	23321251
Down Syndrome	Associate	31611734, 34400791
Drug Related Side Effects and Adverse Reactions	Associate	23532735
Dry Eye Syndromes	Stimulate	23169882
Enteritis	Associate	27672296
Epilepsies Partial	Associate	27915469
Epistaxis	Associate	25853747
Epstein Barr Virus Infections	Associate	26352266, 31184237, 33202420
Fatigue	Associate	35514998
Fatty Liver Alcoholic	Associate	24997224
Fibrosis	Associate	34435646
Gastritis	Inhibit	22524533
Glioblastoma	Associate	21705839, 33735913
Glioma	Associate	34134771, 34643804, 36325335, 37456890
Glomerulonephritis IGA	Associate	32388684
Granuloma Pyogenic	Associate	29269280
Heart Failure	Associate	36733418
Hematologic Neoplasms	Associate	30301877
Hepatitis Alcoholic	Stimulate	24997224
Hepatitis B	Associate	34435646
Hereditary Breast and Ovarian Cancer Syndrome	Associate	35937947
HIV Infections	Associate	29026137, 29778672
HIV Seropositivity	Associate	37979093
Hyperglycemia	Stimulate	25610879
Hyperglycemia	Associate	26959040, 27340831
Hyperkinesis	Associate	25359991
Hyperlipidemias	Associate	26959040
Hypoxia Brain	Associate	35438581
Immune System Diseases	Associate	34778800, 40397075
Immunodeficiency Hypogammaglobulinemia and Reduced B Cells	Associate	32736575
Immunoglobulin Light chain Amyloidosis	Associate	34038803
Infections	Stimulate	32089541
Infections	Associate	33424861
Inflammation	Associate	17255320, 21057262, 22896623, 25320320, 25344726, 25427999, 25965265, 26156799, 26468534, 26581717, 27460076, 28615284, 30013439, 31204533, 31287789 View all (19 more)
Insulin Resistance	Associate	27340831
Intervertebral Disc Degeneration	Associate	36213280
Intra Articular Fractures	Associate	30353605
Intraocular Lymphoma	Associate	32971631, 35200564
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	31301515
Latent Tuberculosis	Associate	29778672
Lead Poisoning Nervous System	Associate	38146363
Leukemia	Associate	37730436
Leukemia B Cell	Associate	21179087, 26193343, 27799566, 29496671, 34163463, 37505783
Leukemia Hairy Cell	Associate	33217360, 37137530
Leukemia Lymphocytic Chronic B Cell	Associate	22150006, 23355535, 24782504, 25480502, 25605254, 26053404, 26230596, 27060156, 27959900, 28399885, 28424451, 30038380, 30087429, 32848129, 33054084 View all (5 more)
Leukemia Prolymphocytic T Cell	Associate	30537114, 30924136
Lichen Planus Oral	Associate	31999637
Lichen Sclerosus et Atrophicus	Stimulate	35399843
Lipase deficiency combined	Associate	33180881
Liver Cirrhosis	Associate	27135246, 34435646
Lung Neoplasms	Associate	35910766
Lupus Erythematosus Systemic	Associate	23497717
Lupus Erythematosus Systemic	Stimulate	34928926
Lyme Disease	Associate	31003080
Lymphadenitis	Associate	31301515
Lymphadenopathy	Associate	24553177
Lymphatic Metastasis	Associate	26600481, 30066873
Lymphoma	Associate	21179087, 22931316, 23976989, 24970810, 25216226, 25359991, 25819228, 25900979, 26230596, 26702065, 27503954, 27915469, 28381754, 28636991, 29151258 View all (41 more)
Lymphoma	Stimulate	37953776
Lymphoma AIDS Related	Associate	40450975
Lymphoma B Cell	Associate	24030746, 25807917, 25819228, 25900979, 28843295, 29122821, 31935288, 32005797, 32161170, 33025009, 33217360, 34330762, 34802044, 35255496, 36982699, 37591861, 39954570 View all (2 more)
Lymphoma B Cell Marginal Zone	Associate	22102703, 23355535, 23720088, 25779943, 25819228, 26498442, 27102345, 28751561, 30198568, 30444439, 32173361, 33217360
Lymphoma Follicular	Associate	24362818, 37493986
Lymphoma Large B Cell Diffuse	Associate	21179087, 22343534, 22808296, 24030746, 24875472, 25900979, 26747248, 26787899, 27102345, 27143257, 27503954, 27835906, 27837631, 27915469, 28479318 View all (38 more)
Lymphoma Large B Cell Diffuse	Stimulate	32932517
Lymphoma Mantle Cell	Associate	32173361, 32591642, 33217360
Lymphoma Non Hodgkin	Associate	23532735, 28751561
Lymphoma Primary Effusion	Associate	32161170
Lymphoproliferative Disorders	Associate	26482097, 31276195
Melanoma	Associate	19001446, 20302635, 32312954
Mental Disorders	Associate	36496170
Metabolic Diseases	Associate	33637950
Metabolic Syndrome	Stimulate	28075222
Methylmalonic Aciduria due to Methylmalonyl CoA Mutase Deficiency	Associate	30401751
Microscopic Polyangiitis	Associate	39672520
Mitochondrial Diseases	Associate	37635482
Monoclonal Gammopathy of Undetermined Significance	Associate	23321251, 23355535, 31483817, 33634586, 36210485
Mucocutaneous Lymph Node Syndrome	Associate	25780885, 34290221, 40367231
Multiple Myeloma	Associate	17363736, 29181840, 29318955, 36752202
Myasthenia Gravis	Associate	37975358
Myelodysplastic Syndromes	Associate	23976989, 29080258, 37172199, 40397075
Neoplasm Invasiveness	Associate	21057262
Neoplasm Metastasis	Associate	20145615, 22533866, 26261595, 30066873, 30203045, 31432177
Neoplasms	Stimulate	20145615, 27301862
Neoplasms	Associate	22931316, 23720088, 24466264, 24977712, 25853747, 26133168, 26867669, 27460076, 27503954, 28235842, 29286214, 29857068, 29899297, 30239551, 30353605 View all (20 more)
Neoplasms Cystic Mucinous and Serous	Associate	24977712
Neurodegenerative Diseases	Associate	34415075
Neuroinflammatory Diseases	Stimulate	36496170
Neuroinflammatory Diseases	Associate	36523959
Neuropathy with Paraprotein in Serum Cerebrospinal Fluid and Urine	Associate	25216226
Neutropenia	Associate	31301515
Obesity	Associate	28075222, 32188105, 33637950
Obesity	Stimulate	31320744
Obesity Abdominal	Associate	31272370
Orbital lymphoma	Associate	27102345
Osteoarthritis	Associate	35992546, 37393232
Osteoglophonic dwarfism	Associate	37635482
Ovarian Neoplasms	Associate	17940625, 19826413, 26223974, 29502561, 33370338
Overweight	Associate	31320744
Pancreatic Neoplasms	Associate	36232715
Papillomavirus Infections	Associate	32089541, 33164635
Paraproteinemias	Associate	28983055, 30026568, 30328142, 31276195, 31483817, 37137530
Paroxysmal ventricular fibrillation	Associate	30027272
Periodontitis	Associate	26581717
Peripheral Nervous System Diseases	Stimulate	27981790
Peritonitis	Associate	34448823
Pleural Effusion Malignant	Associate	32654665
Pneumocephalus	Associate	29895903
Pneumococcal Infections	Associate	21057262
Pneumonia	Associate	35505407
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	35577568, 35798560
Primary Immunodeficiency Diseases	Associate	29269280
Proteinuria	Associate	23355535
Pulmonary Disease Chronic Obstructive	Inhibit	26498252
Pulmonary Disease Chronic Obstructive	Stimulate	33590951
Pyruvate Carboxylase Deficiency Disease	Associate	36752202
Respiratory Distress Syndrome	Associate	28775099, 31261506
Respiratory Distress Syndrome	Inhibit	31261506
Rhinitis Allergic	Stimulate	35190755
Rigid spine syndrome	Associate	24997224
Ring Chromosome 20 Syndrome	Stimulate	37635482
Sarcoma Kaposi	Inhibit	26468534
Sarcoma Kaposi	Associate	32932517, 37730436, 40507898
Schnitzler Syndrome	Associate	31268627, 35514998
Seizures	Associate	38166692
Sertoli Cell Only Syndrome	Associate	21179087
Sezary Syndrome	Associate	28843295
Sjogren's Syndrome	Associate	30446998
Skin Diseases	Associate	32488284
Splenomegaly	Associate	23532735
Squamous Cell Carcinoma of Head and Neck	Associate	22583829, 33637109
Status Asthmaticus	Stimulate	27836955
Still's Disease Adult Onset	Associate	23497717
Stomach Neoplasms	Associate	26700889, 29330337
Syndrome	Associate	24553177
Tertiary Lymphoid Structures	Inhibit	36281585
Testicular Diseases	Associate	27915469
Testicular Neoplasms	Stimulate	40675955
Thromboangiitis Obliterans	Associate	38640750
Thrombosis	Associate	29595637
Thymoma	Associate	37975358
Tuberculosis	Associate	28127112
Tuberculosis Extrapulmonary	Associate	30353605
Tuberculosis Meningeal	Associate	29778672
Turcot syndrome	Associate	35789992
Urachal Cyst	Associate	31301515
Viremia	Associate	30837984
Virus Diseases	Associate	20702616
Waldenstrom Macroglobulinemia	Associate	22931316, 23321251, 23355535, 23532735, 23723443, 23836557, 24224040, 24366360, 24553177, 24786453, 24895570, 25160558, 25341731, 25371371, 25853747 View all (48 more)
WHIM syndrome	Associate	24553177, 25819228, 26002963, 26659815

MYD88 (MYD88 innate immune signal transduction adaptor)