Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4609
Gene name	MYC proto-oncogene, bHLH transcription factor
Gene symbol	MYC
Synonyms (NCBI Gene)	MRTLMYCCbHLHe39c-Myc
Chromosome	8
Chromosome location	8q24.21
Summary	This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28933407	C>T	Pathogenic	Coding sequence variant, missense variant
rs121918683	A>C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121918684	G>C	Pathogenic	Missense variant, coding sequence variant
rs121918685	C>G	Pathogenic	Missense variant, coding sequence variant
rs750664148	A>C,G	Likely-pathogenic	Missense variant, coding sequence variant
rs756091827	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant
rs775522201	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519849	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519850	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519851	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519918	C>T	Likely-pathogenic	Missense variant, coding sequence variant

792

Show/Hide all (792)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Western blot	17877811
MIRT003748	hsa-let-7c-5p	Northern blot	17877811
MIRT004290	hsa-miR-145-5p	qRT-PCRLuciferase reporter assayWestern blot	19202062
MIRT004290	hsa-miR-145-5p	qRT-PCRLuciferase reporter assayWestern blot	19202062
MIRT003438	hsa-miR-98-5p	Luciferase reporter assay	19528081
MIRT003438	hsa-miR-98-5p	Northern blot	19528081
MIRT003438	hsa-miR-98-5p	qRT-PCR	19528081
MIRT003438	hsa-miR-98-5p	ChIP	19528081
MIRT004307	hsa-miR-21-5p	Northern blot	19528081
MIRT004307	hsa-miR-21-5p	qRT-PCR	19528081
MIRT004307	hsa-miR-21-5p	ChIP	19528081
MIRT004401	hsa-miR-34b-5p	ReviewLuciferase reporter assay	19461653
MIRT004402	hsa-miR-34c-5p	ReviewLuciferase reporter assay	19461653
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assayWestern blot	19696787
MIRT000475	hsa-let-7g-5p	qRT-PCRLuciferase reporter assayWestern blot	20309945
MIRT000417	hsa-let-7a-5p	Review	20144549
MIRT003438	hsa-miR-98-5p	Review	20130964
MIRT000417	hsa-let-7a-5p	Review	20179807
MIRT000417	hsa-let-7a-5p	Western blot	20033209
MIRT000121	hsa-miR-24-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	19748357
MIRT000121	hsa-miR-24-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	19748357
MIRT000121	hsa-miR-24-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	19748357
MIRT000121	hsa-miR-24-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	19748357
MIRT005288	hsa-miR-17-5p	Western blot	18695042
MIRT005289	hsa-miR-20a-5p	Western blot	18695042
MIRT005319	hsa-miR-34b-3p	Luciferase reporter assayWestern blot	18768788
MIRT005319	hsa-miR-34b-3p	Luciferase reporter assayWestern blot	18768788
MIRT005319	hsa-miR-34b-3p	ImmunohistochemistryqRT-PCR	18802929
MIRT000417	hsa-let-7a-5p	qRT-PCRWestern blot	16651716
MIRT003968	hsa-miR-26a-5p	Western blot	19524505
MIRT000417	hsa-let-7a-5p	qRT-PCR	17942906
MIRT003438	hsa-miR-98-5p	qRT-PCR	17942906
MIRT005482	hsa-miR-378a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	21242960
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	21294122
MIRT004290	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	21092188
MIRT006015	hsa-miR-371a-3p	In situ hybridizationMicroarrayqRT-PCR	21059911
MIRT006016	hsa-miR-373-3p	In situ hybridizationMicroarrayqRT-PCRWestern blot	21059911
MIRT000695	hsa-miR-34a-5p	qRT-PCRWestern blot	21297663
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006015	hsa-miR-371a-3p	In situ hybridizationMicroarrayqRT-PCR	21059911
MIRT006016	hsa-miR-373-3p	In situ hybridizationMicroarrayqRT-PCRWestern blot	21059911
MIRT000695	hsa-miR-34a-5p	qRT-PCRWestern blot	21297663
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006015	hsa-miR-371a-3p	In situ hybridizationMicroarrayqRT-PCR	21059911
MIRT006016	hsa-miR-373-3p	In situ hybridizationMicroarrayqRT-PCRWestern blot	21059911
MIRT000695	hsa-miR-34a-5p	qRT-PCRWestern blot	21297663
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assay	22159222
MIRT006820	hsa-miR-33b-5p	ImmunohistochemistryqRT-PCR	22887866
MIRT007105	hsa-miR-135a-5p	Luciferase reporter assayWestern blot	23176581
MIRT007308	hsa-miR-449c-5p	Luciferase reporter assay	23507140
MIRT007308	hsa-miR-449c-5p	Luciferase reporter assay	23507140
MIRT016647	hsa-miR-429	Reporter assay;Western blot;Other	21684154
MIRT017925	hsa-miR-335-5p	Microarray	18185580
MIRT017925	hsa-miR-335-5p	Western blot	21618216
MIRT000475	hsa-let-7g-5p	qRT-PCR	21618519
MIRT000475	hsa-let-7g-5p	Western blot;qRT-PCR;Other	20309945
MIRT000695	hsa-miR-34a-5p	Sequencing	20371350
MIRT000695	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR;Microarray;Other	19696787
MIRT003438	hsa-miR-98-5p	Microarray	19088304
MIRT000121	hsa-miR-24-3p	Reporter assay;qRT-PCR;Microarray;Other	19748357
MIRT032089	hsa-let-7f-5p	qRT-PCR	19956384
MIRT052217	hsa-let-7b-5p	CLASH	23622248
MIRT005288	hsa-miR-17-5p	CLASH	23622248
MIRT044759	hsa-miR-320a	CLASH	23622248
MIRT044759	hsa-miR-320a	CLASH	23622248
MIRT038140	hsa-miR-423-5p	CLASH	23622248
MIRT037690	hsa-miR-744-5p	CLASH	23622248
MIRT036232	hsa-miR-320b	CLASH	23622248
MIRT004290	hsa-miR-145-5p	qRT-PCRWestern blot	23710609
MIRT053199	hsa-miR-148a-3p	ImmunoblotMicroarrayqRT-PCR	23389829
MIRT053469	hsa-miR-212-3p	Luciferase reporter assayqRT-PCRWestern blot	21053104
MIRT053756	hsa-miR-494-3p	Luciferase reporter assayqRT-PCRWestern blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assayqRT-PCRWestern blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assayqRT-PCRWestern blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assayqRT-PCRWestern blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assayqRT-PCRWestern blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assayqRT-PCRWestern blot	24612089
MIRT054028	hsa-miR-155-5p	Luciferase reporter assayqRT-PCRWestern blot	24969405
MIRT005319	hsa-miR-34b-3p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22585994
MIRT004402	hsa-miR-34c-5p	ImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22585994
MIRT054238	hsa-miR-33a-5p	ImmunoflourescenceLuciferase reporter assayqRT-PCRWestern blot	23527086
MIRT006358	hsa-miR-451a	Luciferase reporter assay	25310895
MIRT006358	hsa-miR-451a	Luciferase reporter assay	25310895
MIRT037690	hsa-miR-744-5p	Luciferase reporter assayImmunohistochemistryWestern blot	24991193
MIRT437853	hsa-miR-487b-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23426183
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438621	hsa-miR-126-5p	ImmunoblotLuciferase reporter assayqRT-PCR	22972034
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438063	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438037	hsa-miR-93-5p	qRT-PCR	24367666
MIRT437962	hsa-miR-7-5p	qRT-PCR	24707474
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438621	hsa-miR-126-5p	ImmunoblotLuciferase reporter assayqRT-PCR	22972034
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438063	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438037	hsa-miR-93-5p	qRT-PCR	24367666
MIRT437962	hsa-miR-7-5p	qRT-PCR	24707474
MIRT224345	hsa-miR-6507-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	HITS-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	HITS-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	HITS-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	HITS-CLIP	21572407
MIRT499108	hsa-miR-889-5p	HITS-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	HITS-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	HITS-CLIP	21572407
MIRT499106	hsa-miR-622	HITS-CLIP	21572407
MIRT105105	hsa-miR-1827	HITS-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	HITS-CLIP	21572407
MIRT105112	hsa-miR-8074	HITS-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	HITS-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	HITS-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	HITS-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	HITS-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT499106	hsa-miR-622	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT550567	hsa-miR-3133	PAR-CLIP	20371350
MIRT550566	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT105113	hsa-miR-4426	PAR-CLIP	20371350
MIRT105114	hsa-miR-4647	PAR-CLIP	20371350
MIRT105115	hsa-miR-4662b	PAR-CLIP	20371350
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	20371350
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT499108	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT499106	hsa-miR-622	PAR-CLIP	21572407
MIRT105105	hsa-miR-1827	PAR-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	21572407
MIRT105112	hsa-miR-8074	PAR-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT550567	hsa-miR-3133	PAR-CLIP	21572407
MIRT550566	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT105113	hsa-miR-4426	PAR-CLIP	21572407
MIRT105114	hsa-miR-4647	PAR-CLIP	21572407
MIRT105115	hsa-miR-4662b	PAR-CLIP	21572407
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	21572407
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	24398324
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	24398324
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	24398324
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	24398324
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	24398324
MIRT499108	hsa-miR-889-5p	PAR-CLIP	24398324
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	24398324
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	24398324
MIRT499106	hsa-miR-622	PAR-CLIP	24398324
MIRT105105	hsa-miR-1827	PAR-CLIP	24398324
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	24398324
MIRT105112	hsa-miR-8074	PAR-CLIP	24398324
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	24398324
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	24398324
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	24398324
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	24398324
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	24398324
MIRT105126	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT454977	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT454976	hsa-miR-4699-3p	PAR-CLIP	23592263
MIRT105124	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT105125	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT454975	hsa-miR-3919	PAR-CLIP	23592263
MIRT105121	hsa-miR-4289	PAR-CLIP	23592263
MIRT454974	hsa-miR-302a-5p	PAR-CLIP	23592263
MIRT053756	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT000417	hsa-let-7a-5p	TRAP	24510096
MIRT052217	hsa-let-7b-5p	TRAP	24510096
MIRT003748	hsa-let-7c-5p	TRAP	24510096
MIRT439137	hsa-let-7d-5p	TRAP	24510096
MIRT439135	hsa-let-7e-5p	TRAP	24510096
MIRT032089	hsa-let-7f-5p	TRAP	24510096
MIRT000475	hsa-let-7g-5p	TRAP	24510096
MIRT439133	hsa-let-7i-5p	TRAP	24510096
MIRT439112	hsa-miR-1248	TRAP	24510096
MIRT439110	hsa-miR-125a-3p	TRAP	24510096
MIRT439111	hsa-miR-125a-5p	TRAP	24510096
MIRT105090	hsa-miR-1294	TRAP	24510096
MIRT439108	hsa-miR-148a-5p	TRAP	24510096
MIRT439107	hsa-miR-151a-5p	TRAP	24510096
MIRT439105	hsa-miR-16-5p	TRAP	24510096
MIRT439104	hsa-miR-196a-5p	TRAP	24510096
MIRT439103	hsa-miR-196b-5p	TRAP	24510096
MIRT004307	hsa-miR-21-5p	TRAP	24510096
MIRT439102	hsa-miR-222-3p	TRAP	24510096
MIRT439101	hsa-miR-23a-3p	TRAP	24510096
MIRT438796	hsa-miR-25-3p	TRAP	24510096
MIRT105107	hsa-miR-2682-5p	TRAP	24510096
MIRT439099	hsa-miR-30c-5p	TRAP	24510096
MIRT439097	hsa-miR-30d-5p	TRAP	24510096
MIRT439096	hsa-miR-3159	TRAP	24510096
MIRT054238	hsa-miR-33a-5p	TRAP	24510096
MIRT000695	hsa-miR-34a-5p	TRAP	24510096
MIRT004402	hsa-miR-34c-5p	TRAP	24510096
MIRT439093	hsa-miR-375	TRAP	24510096
MIRT105101	hsa-miR-449a	TRAP	24510096
MIRT007308	hsa-miR-449c-5p	TRAP	24510096
MIRT439092	hsa-miR-4510	TRAP	24510096
MIRT439090	hsa-miR-455-3p	TRAP	24510096
MIRT439091	hsa-miR-4677-3p	TRAP	24510096
MIRT439089	hsa-miR-516a-5p	TRAP	24510096
MIRT439087	hsa-miR-92a-3p	TRAP	24510096
MIRT439088	hsa-miR-92b-3p	TRAP	24510096
MIRT105103	hsa-miR-940	TRAP	24510096
MIRT003438	hsa-miR-98-5p	TRAP	24510096
MIRT000417	hsa-let-7a-5p	TRAP	24510096
MIRT052217	hsa-let-7b-5p	TRAP	24510096
MIRT003748	hsa-let-7c-5p	TRAP	24510096
MIRT439137	hsa-let-7d-5p	TRAP	24510096
MIRT439135	hsa-let-7e-5p	TRAP	24510096
MIRT032089	hsa-let-7f-5p	TRAP	24510096
MIRT000475	hsa-let-7g-5p	TRAP	24510096
MIRT439133	hsa-let-7i-5p	TRAP	24510096
MIRT439112	hsa-miR-1248	TRAP	24510096
MIRT439110	hsa-miR-125a-3p	TRAP	24510096
MIRT439111	hsa-miR-125a-5p	TRAP	24510096
MIRT105090	hsa-miR-1294	TRAP	24510096
MIRT439108	hsa-miR-148a-5p	TRAP	24510096
MIRT439107	hsa-miR-151a-5p	TRAP	24510096
MIRT439105	hsa-miR-16-5p	TRAP	24510096
MIRT439104	hsa-miR-196a-5p	TRAP	24510096
MIRT439103	hsa-miR-196b-5p	TRAP	24510096
MIRT004307	hsa-miR-21-5p	TRAP	24510096
MIRT439102	hsa-miR-222-3p	TRAP	24510096
MIRT439101	hsa-miR-23a-3p	TRAP	24510096
MIRT438796	hsa-miR-25-3p	TRAP	24510096
MIRT105107	hsa-miR-2682-5p	TRAP	24510096
MIRT439099	hsa-miR-30c-5p	TRAP	24510096
MIRT439097	hsa-miR-30d-5p	TRAP	24510096
MIRT439096	hsa-miR-3159	TRAP	24510096
MIRT054238	hsa-miR-33a-5p	TRAP	24510096
MIRT000695	hsa-miR-34a-5p	TRAP	24510096
MIRT004402	hsa-miR-34c-5p	TRAP	24510096
MIRT439093	hsa-miR-375	TRAP	24510096
MIRT105101	hsa-miR-449a	TRAP	24510096
MIRT007308	hsa-miR-449c-5p	TRAP	24510096
MIRT439092	hsa-miR-4510	TRAP	24510096
MIRT439090	hsa-miR-455-3p	TRAP	24510096
MIRT439091	hsa-miR-4677-3p	TRAP	24510096
MIRT439089	hsa-miR-516a-5p	TRAP	24510096
MIRT439087	hsa-miR-92a-3p	TRAP	24510096
MIRT439088	hsa-miR-92b-3p	TRAP	24510096
MIRT105103	hsa-miR-940	TRAP	24510096
MIRT003438	hsa-miR-98-5p	TRAP	24510096
MIRT731172	hsa-miR-130a-3p	Luciferase reporter assay	25544755
MIRT731172	hsa-miR-130a-3p	Luciferase reporter assay	25544755
MIRT731172	hsa-miR-130a-3p	Luciferase reporter assay	25544755
MIRT000695	hsa-miR-34a-5p	qRT-PCRWestern blot	25572695
MIRT004290	hsa-miR-145-5p	MicroarrayqRT-PCRWestern blot	26540468
MIRT036232	hsa-miR-320b	Luciferase reporter assayqRT-PCRWestern blot	26487644
MIRT036232	hsa-miR-320b	Luciferase reporter assayqRT-PCRWestern blot	26487644
MIRT006820	hsa-miR-33b-5p	ImmunohistochemistryqRT-PCRWestern blot	26729612
MIRT004290	hsa-miR-145-5p	ImmunoblotLuciferase reporter assayqRT-PCR	26354756
MIRT044759	hsa-miR-320a	Luciferase reporter assayqRT-PCRWestern blot	28243124
MIRT000121	hsa-miR-24-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26159387
MIRT006358	hsa-miR-451a	Luciferase reporter assayqRT-PCRWestern blot	27571748
MIRT105101	hsa-miR-449a	Luciferase reporter assayWestern blot	27250340
MIRT105101	hsa-miR-449a	Luciferase reporter assayWestern blot	27250340
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	27292025
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	27292025
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	27292025
MIRT732853	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blotting	33111613
MIRT731172	hsa-miR-130a-3p	Microarray	32046751
MIRT005319	hsa-miR-34b-3p	Western blottingMicroarrayImmunohistochemistry (IHC)qRT-PCR	33300049
MIRT736643	hsa-miR-182-3p	Luciferase reporter assayWestern blottingqRT-PCR	32867570
MIRT438802	hsa-miR-106b-5p	qRT-PCR	33430425
MIRT224345	hsa-miR-6507-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	HITS-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	HITS-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	HITS-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	HITS-CLIP	21572407
MIRT499108	hsa-miR-889-5p	HITS-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	HITS-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	HITS-CLIP	21572407
MIRT499106	hsa-miR-622	HITS-CLIP	21572407
MIRT105105	hsa-miR-1827	HITS-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	HITS-CLIP	21572407
MIRT105112	hsa-miR-8074	HITS-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	HITS-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	HITS-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	HITS-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	HITS-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT499106	hsa-miR-622	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT550567	hsa-miR-3133	PAR-CLIP	20371350
MIRT550566	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT105113	hsa-miR-4426	PAR-CLIP	20371350
MIRT105114	hsa-miR-4647	PAR-CLIP	20371350
MIRT105115	hsa-miR-4662b	PAR-CLIP	20371350
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	20371350
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT499108	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT499106	hsa-miR-622	PAR-CLIP	21572407
MIRT105105	hsa-miR-1827	PAR-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	21572407
MIRT105112	hsa-miR-8074	PAR-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT550567	hsa-miR-3133	PAR-CLIP	21572407
MIRT550566	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT105113	hsa-miR-4426	PAR-CLIP	21572407
MIRT105114	hsa-miR-4647	PAR-CLIP	21572407
MIRT105115	hsa-miR-4662b	PAR-CLIP	21572407
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	21572407
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	24398324
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	24398324
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	24398324
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	24398324
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	24398324
MIRT499108	hsa-miR-889-5p	PAR-CLIP	24398324
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	24398324
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	24398324
MIRT499106	hsa-miR-622	PAR-CLIP	24398324
MIRT105105	hsa-miR-1827	PAR-CLIP	24398324
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	24398324
MIRT105112	hsa-miR-8074	PAR-CLIP	24398324
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	24398324
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	24398324
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	24398324
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	24398324
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	24398324
MIRT105126	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT454977	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT454976	hsa-miR-4699-3p	PAR-CLIP	23592263
MIRT105124	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT105125	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT454975	hsa-miR-3919	PAR-CLIP	23592263
MIRT105121	hsa-miR-4289	PAR-CLIP	23592263
MIRT454974	hsa-miR-302a-5p	PAR-CLIP	23592263
MIRT053756	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT755383	hsa-miR-320b	Western blottingqRT-PCR	38260139
MIRT755557	hsa-miR-3189-3p	Luciferase reporter assayWestern blottingqRT-PCR	35642054
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167693	hsa-miR-1202	CLIP-seq
MIRT1167694	hsa-miR-1252	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167698	hsa-miR-186	CLIP-seq
MIRT1167699	hsa-miR-200b	CLIP-seq
MIRT1167700	hsa-miR-200c	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167702	hsa-miR-24	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167704	hsa-miR-3154	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167709	hsa-miR-369-3p	CLIP-seq
MIRT1167710	hsa-miR-374a	CLIP-seq
MIRT1167711	hsa-miR-374b	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167714	hsa-miR-3972	CLIP-seq
MIRT1167715	hsa-miR-4282	CLIP-seq
MIRT1167716	hsa-miR-4284	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167718	hsa-miR-4477a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167721	hsa-miR-4652-3p	CLIP-seq
MIRT1167722	hsa-miR-4776-3p	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT1167727	hsa-miR-548ac	CLIP-seq
MIRT1167728	hsa-miR-548ae	CLIP-seq
MIRT1167729	hsa-miR-548aj	CLIP-seq
MIRT1167730	hsa-miR-548am	CLIP-seq
MIRT1167731	hsa-miR-548d-3p	CLIP-seq
MIRT1167732	hsa-miR-548x	CLIP-seq
MIRT1167733	hsa-miR-548z	CLIP-seq
MIRT1167734	hsa-miR-561	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167693	hsa-miR-1202	CLIP-seq
MIRT1167694	hsa-miR-1252	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167704	hsa-miR-3154	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167714	hsa-miR-3972	CLIP-seq
MIRT2048397	hsa-miR-4263	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167718	hsa-miR-4477a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167721	hsa-miR-4652-3p	CLIP-seq
MIRT1167722	hsa-miR-4776-3p	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT2048398	hsa-miR-4799-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT1167727	hsa-miR-548ac	CLIP-seq
MIRT1167728	hsa-miR-548ae	CLIP-seq
MIRT1167729	hsa-miR-548aj	CLIP-seq
MIRT1167730	hsa-miR-548am	CLIP-seq
MIRT1167731	hsa-miR-548d-3p	CLIP-seq
MIRT1167732	hsa-miR-548x	CLIP-seq
MIRT1167733	hsa-miR-548z	CLIP-seq
MIRT2048399	hsa-miR-576-5p	CLIP-seq
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167693	hsa-miR-1202	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167699	hsa-miR-200b	CLIP-seq
MIRT1167700	hsa-miR-200c	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167702	hsa-miR-24	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT2277220	hsa-miR-296-3p	CLIP-seq
MIRT1167704	hsa-miR-3154	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167714	hsa-miR-3972	CLIP-seq
MIRT1167716	hsa-miR-4284	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167721	hsa-miR-4652-3p	CLIP-seq
MIRT1167722	hsa-miR-4776-3p	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT2277221	hsa-miR-629	CLIP-seq
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167718	hsa-miR-4477a	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT1167734	hsa-miR-561	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq

Show/Hide all (93)

Transcription factor	Regulation	Reference
AATF	Activation	20549547
AHR	Unknown	11114727;16091746
APC	Repression	16510874
AR	Unknown	24512546
BCL6	Activation	21394099
BDP1	Unknown	12734418
BIN1	Unknown	9797456
BRCA1	Unknown	12032322;12646176
CEBPA	Repression	12032779
CEBPE	Repression	12947005
CHD8	Unknown	16949368
CNBP	Unknown	23774591
CTCF	Activation	19568426
CTCF	Repression	12032779;12524457
CTCF	Unknown	24725430;9591631
CTNNB1	Activation	20300972;21533051
CTNNB1	Unknown	17724465;18679417;19662654;19778454
DLX5	Activation	19497851
E2F1	Activation	11705881
E2F4	Unknown	17132729
E2F5	Unknown	17132729
ENO1	Repression	10681589;9119380
ENO1	Unknown	10528225;10802057;18490439;20412594;7880838
EP300	Repression	19279113
ESR1	Unknown	11517191;19569049;22892083
ETS2	Unknown	22108824
EZH2	Repression	23079660
FOS	Repression	2498162
FOXA1	Unknown	24512546
FOXM1	Activation	23804320
FUBP1	Unknown	11239393;18193062;24117486
HDAC11	Unknown	20493879
HDAC2	Unknown	20493879
HDAC3	Repression	19279113;23079660;23714368
HIC1	Repression	24067369
HNF4A	Activation	23714368
HOXA1	Activation	15665309
IFI16	Repression	20052289
JUN	Repression	2498162
L3MBTL1	Unknown	23543057
LEF1	Unknown	19620402
MAX	Unknown	9797456
MTA1	Unknown	12431981
MXI1	Repression	8838813
MYB	Activation	1594249
MYB	Unknown	11259163;16088151;19609274
MYBL2	Activation	1594249
NF1	Activation	9562250
NFKB1	Activation	17018379
NFKB1	Repression	18566231
NFKB1	Unknown	11114727;12894581;17673602;17944672;18184402;19469019;19766095;21790895
PGR	Unknown	22892083
PPARG	Repression	11973610
PRDM1	Repression	10713181;12032779
PTTG1	Activation	22475756
PTTG1	Unknown	11115508
RB1	Repression	10200487;9671466
RB1	Unknown	7680889
RBL1	Unknown	17132729;9797456
RELA	Activation	17018379
RELA	Repression	18566231
RELA	Unknown	11114727;12894581;17673602;17944672;18184402;19469019;19766095;21790895
RFX1	Repression	10918054;12032779
RUNX3	Repression	20442291
SIRT1	Repression	22245592;22483777
SMAD3	Unknown	17132729
SMAD4	Unknown	17132729
SMAD7	Activation	15555279
SNIP1	Unknown	17157259
SP1	Unknown	2057364;8355712
SRSF1	Unknown	22545246
STAT3	Activation	15184887;17204573;19259613
STAT3	Repression	20067773;22317895
STAT3	Unknown	10464281;15469392;18184402;20654581
STAT4	Activation	10702306
TBL1X	Unknown	20493879
TBP	Unknown	7880838;9797456
TCF3	Activation	22384858
TCF3	Repression	21788410
TCF4	Activation	21533051
TCF4	Unknown	15928669;19561604;19662654;19778454
TLX1	Activation	20618946
TP53	Repression	19411072
TP53	Unknown	19202062
WDR5	Unknown	24782528
WT1	Repression	17634147
WT1	Unknown	15286719
YY1	Activation	18490439
YY1	Repression	19279113
YY1	Unknown	10528225;17434929;9797456
ZBTB7A	Repression	17189472
ZNF300	Activation	21777376
ZNF382	Repression	20682794

131

Show/Hide all (131)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	25438055
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	9924025, 10412034, 18393360, 19160485
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19786833
GO:0000165	Process	MAPK cascade	IMP	17873522
GO:0000785	Component	Chromatin	IDA	30158517
GO:0000785	Component	Chromatin	IMP	12837246
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10723141
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	19786833
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	9924025, 10723141
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	25956029
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	30873824
GO:0001221	Function	Transcription coregulator binding	IPI	15674325
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	29203640
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	19786833
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10723141, 27791094
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0001783	Process	B cell apoptotic process	IEA
GO:0001866	Process	NK T cell proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	ISS
GO:0002904	Process	Positive regulation of B cell apoptotic process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	10597290
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	8755740, 9184233, 9308237, 9708738, 10597290, 11891322, 12706874, 15103331, 15663936, 15992821, 16352593, 16606833, 16996503, 17070091, 17157259, 17314511, 17418410, 17599065, 17632056, 17873522, 18256156, 18393360, 18413597, 18620061, 18923429, 19131971, 19786833, 20195357, 2020851
GO:0005634	Component	Nucleus	IDA	8782822, 11793365, 15358760, 15994933, 18393360
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8425218
GO:0005634	Component	Nucleus	TAS	9187264
GO:0005654	Component	Nucleoplasm	IDA	17558397
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	17558397, 25775507, 38225354
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21533051
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IDA	9924025
GO:0006974	Process	DNA damage response	IDA	17873522
GO:0006974	Process	DNA damage response	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15994933
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0009314	Process	Response to radiation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEP	18291362
GO:0010468	Process	Regulation of gene expression	IDA	21447833
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010564	Process	Regulation of cell cycle process	IDA	8782822
GO:0010628	Process	Positive regulation of gene expression	IDA	15459207
GO:0010628	Process	Positive regulation of gene expression	IGI	15459207
GO:0014902	Process	Myotube differentiation	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016072	Process	RRNA metabolic process	IMP	38225354
GO:0016485	Process	Protein processing	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0030424	Component	Axon	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032204	Process	Regulation of telomere maintenance	IMP	17765874
GO:0032206	Process	Positive regulation of telomere maintenance	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	ISS
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	ISS
GO:0032986	Process	Protein-DNA complex disassembly	IDA	19160485
GO:0032991	Component	Protein-containing complex	IDA	17873522, 19160485
GO:0034644	Process	Cellular response to UV	IEP	17873522
GO:0035457	Process	Cellular response to interferon-alpha	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042474	Process	Middle ear morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IPI	9184233, 25609649
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29203640
GO:0043279	Process	Response to alkaloid	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IMP	19786833
GO:0044346	Process	Fibroblast apoptotic process	TAS	10962037
GO:0044877	Function	Protein-containing complex binding	IDA	18987311
GO:0045656	Process	Negative regulation of monocyte differentiation	IMP	9924025
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	8425218, 10962037, 17558397, 18818310
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12676957, 17884155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10723141
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9924025
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	9924025, 18987311
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	15674325
GO:0048147	Process	Negative regulation of fibroblast proliferation	IDA	10962037
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	18987311
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	IEA
GO:0051276	Process	Chromosome organization	IDA	10962037
GO:0051782	Process	Negative regulation of cell division	IDA	10962037
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IEA
GO:0060633	Process	Negative regulation of transcription initiation by RNA polymerase II	IDA	29203640
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	15459207
GO:0070848	Process	Response to growth factor	TAS	18987311
GO:0070888	Function	E-box binding	IDA	18818310, 27791094
GO:0071456	Process	Cellular response to hypoxia	IDA	15459207
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	17873522
GO:0071943	Component	Myc-Max complex	IEA
GO:0071943	Component	Myc-Max complex	IPI	12553908
GO:0090096	Process	Positive regulation of metanephric cap mesenchymal cell proliferation	IEA
GO:0090096	Process	Positive regulation of metanephric cap mesenchymal cell proliferation	ISS
GO:0090571	Component	RNA polymerase II transcription repressor complex	IPI	15992821, 18393360
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15674325, 19160485
GO:1902255	Process	Positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator	IDA	10962037
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	27791094
GO:1904672	Process	Regulation of somatic stem cell population maintenance	IEA
GO:1904672	Process	Regulation of somatic stem cell population maintenance	ISS
GO:1904699	Process	Positive regulation of acinar cell proliferation	IEA
GO:1905761	Function	SCF ubiquitin ligase complex binding	IPI	12769844, 15103331, 15150404
GO:1990863	Process	Acinar cell proliferation	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
190080	7553	ENSG00000136997

P01106

Protein name

Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)

Protein function

Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3' (PubMed:24940000, PubMed:25956029). Activates the transcription of growth-related genes (PubMed:24940000, PubMed:259

PDB

1A93 , 1EE4 , 1MV0 , 1NKP , 2A93 , 2OR9 , 4Y7R , 5I4Z , 5I50 , 6C4U , 6E16 , 6E24 , 6G6J , 6G6K , 6G6L , 7T1Y , 7T1Z , 8J2Q , 8OTS , 8OTT , 8Q1N , 8WLG , 8X8S , 8X8V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01056	Myc_N	1 → 345	Myc amino-terminal region	Family
PF00010	HLH	355 → 407	Helix-loop-helix DNA-binding domain	Domain
PF02344	Myc-LZ	408 → 438	Myc leucine zipper domain	Coiled-coil

Sequence

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA

Sequence length

439

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway ErbB signaling pathway Cell cycle PI3K-Akt signaling pathway Cellular senescence Wnt signaling pathway TGF-beta signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells JAK-STAT signaling pathway Thyroid hormone signaling pathway Salmonella infection Hepatitis C Hepatitis B Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Pathways in cancer Transcriptional misregulation in cancer Proteoglycans in cancer MicroRNAs in cancer Chemical carcinogenesis - receptor activation Colorectal cancer Endometrial cancer Thyroid cancer Bladder cancer Chronic myeloid leukemia Acute myeloid leukemia Small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer Central carbon metabolism in cancer		Transcription of E2F targets under negative control by DREAM complex NOTCH1 Intracellular Domain Regulates Transcription SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Binding of TCF/LEF:CTNNB1 to target gene promoters MAPK6/MAPK4 signaling Ub-specific processing proteases Interleukin-4 and Interleukin-13 signaling Cyclin E associated events during G1/S transition Cyclin A:Cdk2-associated events at S phase entry TFAP2 (AP-2) family regulates transcription of cell cycle factors RUNX3 regulates WNT signaling Estrogen-dependent gene expression

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Acute myeloid leukemia	Pathogenic	rs750664148	RCV003883217
Burkitt lymphoma	Pathogenic	rs28933407, rs121918683, rs121918684	RCV000013402 RCV000013403 RCV000013404

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cholesteatoma of middle ear	other	rs2130093441, rs121918685	RCV003159078 RCV003159073
Classic Hodgkin lymphoma	Uncertain significance	rs4645959	RCV002227948
MYC-related disorder	Uncertain significance; Benign; Likely benign	rs4645959, rs2070582, rs760785153	RCV003971198 RCV003974054 RCV003977180
Neoplasm	other	rs121918685	RCV004668720
Premature ovarian failure	Uncertain significance	rs1813651626	RCV001270210
Rhabdomyosarcoma	-	rs775522201	RCV006254937

Show/Hide Text Mining Associations (656)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Stimulate	25479599
Abnormalities Drug Induced	Associate	27463019
Abortion Habitual	Inhibit	28661480
Accessory Nerve Injuries	Associate	35892263
Achalasia Addisonianism Alacrimia syndrome	Associate	26892631, 26931436, 29785017, 29903764, 30210134, 31171907, 31288832, 31315646, 31518494, 32311849, 33168821, 34289655, 34698437, 36823603
Acidosis	Inhibit	24152439
Acne Vulgaris	Associate	24114350
Acquired Immunodeficiency Syndrome	Associate	17405744, 20614267, 2840989, 3491176, 8043869
Acquired Immunodeficiency Syndrome	Stimulate	8025268
Acute Aortic Syndrome	Associate	33953793
Acute erythroleukemia	Associate	28359056, 37377612
Adenocarcinoma	Stimulate	12524396, 21892521
Adenocarcinoma	Associate	1687493, 16984727, 1752978, 18493233, 19331129, 19596931, 20565940, 20651033, 22450065, 22585994, 23866769, 24568597, 2547415, 26104750, 26926447 View all (10 more)
Adenocarcinoma Follicular	Associate	28974238
Adenocarcinoma Mucinous	Associate	16308474, 26797085
Adenocarcinoma of Lung	Associate	21151896, 23239811, 24809777, 25026294, 25079552, 25333250, 25896422, 26483346, 26656844, 27151654, 27402308, 31432162, 31862696, 32791233, 33540574 View all (6 more)
Adenoma	Associate	21102417, 27245242, 28533663, 36631756, 37667332, 8347498, 9293892
Adenoma	Stimulate	27479195, 30130159
Adenoma Oxyphilic	Associate	8943742
Adenoma Pleomorphic	Associate	9723034
Adenomatous Polyposis Coli	Associate	11950812, 20628379, 2826545, 31520998, 31623618, 32259481
Adenomatous Polyposis Coli	Inhibit	28731177
Adenomatous Polyps	Associate	30412224
Adrenocortical Carcinoma	Associate	35279598
Adrenoleukodystrophy	Associate	29065337
Aging Premature	Associate	35069971
AIDS related Kaposi sarcoma	Associate	8952524
Airway Remodeling	Associate	34939316
Allan Herndon Dudley syndrome	Stimulate	22515221
Alzheimer Disease	Associate	26059363, 29753274, 31401456, 31698192
Amaurosis congenita of Leber type 1	Associate	37014508
Amyotrophic Lateral Sclerosis	Associate	26075709, 34662711
Anal Gland Neoplasms	Associate	10195031
Anaplasia	Associate	17254356, 19134217
Anemia Aplastic	Associate	26354756
Anemia Hemolytic Autoimmune	Associate	2179128
Anemia Refractory with Excess of Blasts	Associate	19454499
Aneuploidy	Associate	17036397, 34131801
Aneuploidy	Stimulate	21102417, 2538323
Aneurysm	Associate	23825360
Angiosarcoma of the breast	Associate	26632799
Anophthalmia with pulmonary hypoplasia	Associate	39358545
Anus Neoplasms	Associate	7679417
Aortic Dissection	Associate	28076932
Aphasia Broca	Associate	32780847
Appendicitis	Associate	39252332
Arrhythmias Cardiac	Associate	26387865
Arteriosclerosis Obliterans	Associate	26159387
Arthritis Rheumatoid	Inhibit	10323451
Arthritis Rheumatoid	Associate	15589822, 35886000
Arthropathy progressive pseudorheumatoid of childhood	Associate	31213128
Ascites	Associate	26261666, 32713346
Astrocytoma	Associate	11381677, 19143767, 20068183, 22805177, 23934175, 29523126, 36260562
Ataxia Telangiectasia	Associate	39940843
Atrial Fibrillation	Associate	33747117
Atypical Squamous Cells of the Cervix	Associate	23408758
Autism Spectrum Disorder	Associate	34438162
Autoimmune Diseases	Associate	2179128, 27630164, 34857874
Barrett Esophagus	Stimulate	12524396, 26297437
Barrett Esophagus	Associate	18953412, 26104750, 26926447
Blast Crisis	Associate	18534064, 32517078
Bone Diseases	Associate	16497877, 22330139, 31391404
Bone Marrow Diseases	Stimulate	12745652
Bone Marrow Diseases	Associate	2070052, 32273477
Bone Marrow Failure Disorders	Associate	33417873
Bone Neoplasms	Associate	35141331
Bowen's Disease	Inhibit	28339425
Brain Neoplasms	Associate	18059365, 27852622, 29117471, 3001737, 33430425, 37147437, 37423059
Breast Neoplasms	Associate	10604737, 11158583, 11304576, 11706062, 12032322, 12379776, 1309531, 14997205, 15083194, 15743499, 15757889, 15803183, 15808510, 16107734, 16497871 View all (216 more)
Breast Neoplasms	Stimulate	12817989, 23704974
Breast Neoplasms	Inhibit	40362536
Breast Neoplasms Male	Associate	11449307, 20152033, 22527098
Brenner Tumor	Associate	26797085
Bronchiolitis Obliterans Syndrome	Associate	18354170
Burkitt Lymphoma	Associate	10022853, 10550304, 10556095, 10618400, 10706881, 10828444, 10866684, 10997962, 11072243, 11777933, 11917131, 12515726, 12553908, 12594230, 12670331 View all (208 more)
Burkitt Lymphoma	Stimulate	29132323, 31560931
Calcinosis Cutis	Associate	18567993, 20388805, 22056952, 22281794, 27662660, 30033370, 33737307, 35806108, 39207954
Calcinosis Cutis	Stimulate	35562350
Cap Myopathy	Associate	16827116
Carcinogenesis	Associate	10036781, 11115508, 11865060, 12378623, 12657136, 12842909, 15199147, 15382088, 15493579, 15528212, 15644444, 1569190, 15810077, 16280331, 16474375 View all (78 more)
Carcinogenesis	Inhibit	20123981
Carcinogenesis	Stimulate	24586304, 25921139, 32732221, 33351778, 36433941, 37148657
Carcinoma	Associate	24708907, 28339425, 28974238
Carcinoma Adenoid Cystic	Associate	21204718, 29954240, 39230995
Carcinoma Adenoid Cystic	Stimulate	33172898
Carcinoma Adenosquamous	Associate	25855536, 35535581
Carcinoma Basal Cell	Inhibit	11348463
Carcinoma Basal Cell	Associate	19470724, 26954716
Carcinoma Bronchogenic	Associate	12876208
Carcinoma Ductal	Associate	20473280, 22052326, 28618949, 3014513
Carcinoma Ductal	Stimulate	31350286
Carcinoma Ductal Breast	Associate	1309531
Carcinoma Endometrioid	Associate	36140779
Carcinoma Endometrioid	Stimulate	37655078
Carcinoma Hepatocellular	Associate	12378623, 12436441, 14991929, 15078869, 15133868, 19948069, 21059911, 21499307, 2161812, 21659362, 21691299, 22302044, 22912812, 22962849, 23015317 View all (77 more)
Carcinoma Hepatocellular	Stimulate	19276364, 28258914
Carcinoma Hepatocellular	Inhibit	21903590, 27465549
Carcinoma in Situ	Associate	2631744
Carcinoma Intraductal Noninfiltrating	Associate	17309600, 23062488
Carcinoma Large Cell	Associate	2200538, 33031101, 38237798
Carcinoma Lobular	Associate	31229512
Carcinoma Medullary	Associate	37236926
Carcinoma Neuroendocrine	Associate	33514539, 34326338, 36694106, 36807750, 37517480
Carcinoma Non Small Cell Lung	Associate	10339988, 1690210, 19204574, 21092188, 21642861, 23239811, 24469837, 2547415, 25613309, 25806711, 26722426, 27083050, 27231235, 27501049, 27656838 View all (30 more)
Carcinoma Ovarian Epithelial	Associate	19524285, 23791828, 25204737, 26908019, 33081171, 33804458, 9475195
Carcinoma Pancreatic Ductal	Associate	24807963, 25855536, 28007776, 28720843, 31243599, 31311829, 31311847, 32200350, 32350415, 33099868, 33390837, 33525943, 33932087, 34419070, 34925373 View all (7 more)
Carcinoma Pancreatic Ductal	Inhibit	35771494
Carcinoma Renal Cell	Stimulate	12853350, 21982273, 22286234, 33547292
Carcinoma Renal Cell	Associate	17482131, 19061835, 19087307, 21725288, 21881486, 22159222, 22430804, 23176581, 23799849, 23951092, 24763884, 25227113, 27366943, 28281968, 29180625 View all (13 more)
Carcinoma Signet Ring Cell	Associate	16308474
Carcinoma Small Cell	Associate	17469181, 28951314, 36216793, 36715552
Carcinoma Squamous Cell	Associate	10514383, 19596931, 24205356, 2631744, 27452220, 28339425, 29525942, 30683916, 31829519, 32108138, 33629937, 33925297, 36005200, 36012403, 36051475, 9462237, 9484827 View all (2 more)
Carcinoma Squamous Cell	Stimulate	28679648
Carcinoma Transitional Cell	Associate	12237776
Carcinosarcoma	Associate	25918253
Cardiomyopathies	Associate	27050951
Cardiomyopathy Dilated	Associate	27050951, 27974462
Cell Transformation Neoplastic	Stimulate	16280331
Cell Transformation Neoplastic	Associate	24831540, 25669969, 27923907, 29328367, 36763589, 38005222
Cell Transformation Viral	Associate	25596731, 34749168
Central Nervous System Diseases	Associate	25130212, 26834242, 27687005
Central Nervous System Infections	Associate	25479599, 29428974, 37236124
Central Nervous System Neoplasms	Associate	29428974
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	14997205
Cerebrospinal Fluid Rhinorrhea	Associate	18452568
Chagas Disease	Associate	26919708
Chemical and Drug Induced Liver Injury	Associate	16610058
Cholangiocarcinoma	Associate	23480758, 29976634, 30235453, 32173382, 32246704, 32453420, 35113866, 35758372, 37576707
Cholangitis Sclerosing	Associate	35897137
Cholesteatoma	Associate	24683550
Cholesteatoma	Stimulate	32915926
Chondrosarcoma	Associate	28522217, 29138803, 35141331
Choriocarcinoma	Associate	7951513
Choristoma	Associate	22884659
Chromosomal Instability	Stimulate	17297307
Chromosomal Instability	Associate	32879494, 39227622
Chromosome 1 monosomy 1p	Associate	27090007
Chromosome 11 partial trisomy 11q	Associate	25677902
Chromosome 14 trisomy	Associate	16258503, 18024371
Chromosome 1q21.1 Deletion Syndrome 1.35 Mb	Associate	25853389, 26222673
Chromosome 7 monosomy	Stimulate	19895612, 22524974
Chromosome 8 deletion	Associate	17036397
Chromosome 8 trisomy	Stimulate	22524974
Chromosome 8 trisomy	Associate	24947144
Chromosome Aberrations	Associate	17405744, 17643093, 18477041, 18612102, 18647998, 19633642, 20348878, 27093450, 31357093
Chromosome Disorders	Associate	17297307, 18245958
Chronic Disease	Stimulate	34220309
Cognitive Dysfunction	Inhibit	35283023
Colitis Associated Neoplasms	Associate	31972160
Colitis Ulcerative	Stimulate	1612482
Colitis Ulcerative	Associate	24118792, 31330513, 33299870
Colonic Diseases	Associate	1586594
Colonic Neoplasms	Associate	15493579, 1569190, 1586594, 16940161, 18802399, 19672269, 20841488, 23613397, 2542967, 27245242, 27273865, 2820714, 2876925, 3128541, 31370719 View all (7 more)
Colonic Neoplasms	Stimulate	20383323
Colonic Polyps	Associate	3511934
Colorectal Neoplasms	Associate	11260862, 15750208, 1586594, 16308474, 16367922, 16543245, 16882699, 16940161, 17278192, 17297307, 17572360, 17848589, 17881904, 18694522, 18802399 View all (160 more)
Colorectal Neoplasms	Stimulate	22496461, 24240588, 28165564, 32258125, 38637125, 8376401
Colorectal Neoplasms	Inhibit	40362536
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	23951239, 32102509
Colorectal Neoplasms Hereditary Nonpolyposis	Stimulate	30412224
Complement Component C1s Deficiency	Associate	31537905
Congenital bilateral aplasia of vas deferens	Associate	32054096
Congenital myasthenic syndrome ib	Stimulate	24589226
Coronary Artery Disease	Associate	31881747, 31886261
Coronary Restenosis	Associate	11788220
Coronavirus Infections	Associate	33968364
COVID 19	Associate	37486005, 37796681
Crigler Najjar Syndrome	Associate	33485181
Crohn Disease	Stimulate	1612482
Crohn Disease	Associate	30794691
Cryptorchidism	Associate	23025704
Cystic Fibrosis	Associate	30598261, 32777768, 35843019, 36067639
Cysts	Associate	34815804
Cytomegalovirus Infections	Stimulate	37147437
De Lange Syndrome	Inhibit	23106691
De Lange Syndrome	Associate	29088292, 34849865
Deafness	Associate	19482502
Death	Associate	12745652, 1638027, 18780787, 22005580, 22168746, 24506200, 24809777, 27687005, 28749548, 29180625, 33008815
Death	Stimulate	40461625
Death	Inhibit	8219202
Demyelinating Diseases	Associate	18836552
Denys Drash Syndrome	Associate	35667217
Dermatomyositis	Associate	37928522
Diabetes Mellitus	Associate	17355243, 36473131
Diabetes Mellitus Type 1	Associate	29180625, 34031141, 35650387, 39464889
Diabetes Mellitus Type 2	Associate	27380896, 37028179, 40127075
Diabetic Nephropathies	Associate	35932042
Diastrophic dysplasia	Associate	22820187
DiGeorge Syndrome	Associate	26221035
Disease	Associate	31932576, 3549790, 37796681
DNA Virus Infections	Associate	22084162
Down Syndrome	Associate	16492768, 33220594, 38513239
Drug Fever	Inhibit	18802399
Drug Related Side Effects and Adverse Reactions	Inhibit	10323451, 36289430, 39596160
Drug Related Side Effects and Adverse Reactions	Associate	11381677, 18375382, 20428086, 23237561, 23840064, 25127121, 28031235, 29954751, 30194076, 34448104, 35414060, 37353799, 39341827, 39457457, 8065303, 8816437 View all (1 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	21324178
Endocrine System Diseases	Associate	25683269
Endometrial Hyperplasia	Stimulate	37655078
Endometrial Neoplasms	Associate	14663583, 16681770, 1687493, 21305022, 21543766, 23028803, 23393560, 25214561, 26407074, 26656844, 26859414, 27572308, 29984790, 34831139, 35080085 View all (10 more)
Endometriosis	Associate	16150151, 22884659, 26198055, 36510984
Enteropathy Associated T Cell Lymphoma	Associate	22654438, 26226842
Eosinophilia	Associate	32958266
Ependymoma	Associate	28371821, 33430425, 34895332, 35803925
Epidermolysis bullosa simplex Ogna type	Associate	28675510
Epilepsy Idiopathic Generalized	Associate	30675171
Epstein Barr Virus Infections	Associate	11917131, 16609989, 18240345, 19283066, 20962620, 22661084, 29118124, 3032447, 32273478, 32727118, 33297669, 35650679, 37409959
Epstein Barr Virus Infections	Stimulate	16611410, 25099163, 3039510
Esophageal Achalasia	Associate	20163722
Esophageal Neoplasms	Associate	16425431, 17317935, 19084934, 20890087, 24488669, 25925090, 33577050, 34284990, 34712552, 35879265, 36433943
Esophageal Neoplasms	Stimulate	24022664, 36624401
Esophageal Squamous Cell Carcinoma	Associate	10514383, 18084253, 21734802, 22450065, 22578181, 25925090, 26490982, 27721245, 27956804, 28591712, 28671049, 30551519, 31851786, 31856412, 31886273 View all (12 more)
Extranodal Extension	Associate	17197434
Extravasation of Diagnostic and Therapeutic Materials	Associate	16848772
Fabry Disease	Associate	36917862
Familial cylindromatosis	Associate	25351503
familial dilated cardiomyopathy	Associate	36355424
Familial Primary Pulmonary Hypertension	Associate	25290246
Fanconi Anemia	Associate	33417873
Fatty Liver	Associate	27789406, 27789412
Fetal Growth Retardation	Associate	20008130
Fibroadenoma	Associate	15646810
Fibrocartilaginous embolism	Associate	32016951, 34222486
Fibrolamellar hepatocellular carcinoma	Associate	28270654, 36692000
Fibrosarcoma	Associate	8816437
Fibrosis	Associate	16610058, 33214068, 36473131, 37014433
Focal cortical dysplasia of Taylor	Associate	20613634
Focal Nodular Hyperplasia	Associate	28974238
Fused Teeth	Associate	23341189, 23600716, 24625454, 26931436, 29903764, 31518494
Gallbladder Neoplasms	Associate	24953832
Gastritis Atrophic	Associate	15188501
Gastrointestinal Neoplasms	Associate	12377807, 31648989, 40185335
Gastrointestinal Stromal Tumors	Associate	15864317, 21192842, 31570771
GATA2 Deficiency	Associate	12460470, 26337274, 32641029
Gaucher Disease	Inhibit	31765939
Genetic Diseases Inborn	Associate	1485535, 15781629, 23494176, 27283966, 31109360, 31117293, 31315646
Genital Neoplasms Male	Associate	1649348
Genomic Instability	Associate	20930934
Germinoma	Associate	38430549
Glaucoma 3 Primary Congenital A	Associate	29453128
Glioblastoma	Associate	11351043, 11381677, 11909963, 18694480, 19189656, 19602686, 23362460, 23715499, 23934175, 24196438, 25033601, 25050814, 26563484, 27119353, 27409345 View all (23 more)
Glioma	Associate	11522296, 17572360, 22945648, 23934175, 23967279, 24325785, 27090007, 27282637, 28790340, 30795814, 30927504, 31740732, 32322592, 32916774, 33367952 View all (14 more)
Glioma Subependymal	Associate	22805177
Glomerulonephritis IGA	Associate	15208647, 1712408, 27730700
Glomus vagale tumors	Associate	22405651
Glucosephosphate Dehydrogenase Deficiency	Associate	26366417, 32722781
Glycogen Storage Disease Type IV	Associate	16848772, 32877461
Glycosuria Renal	Associate	19087307
Graft vs Host Disease	Associate	35401560
Growth Hormone Secreting Pituitary Adenoma	Associate	8943742
Head and Neck Neoplasms	Associate	20614267, 21123375, 29790697, 30068946, 31833149, 32019273, 33859744, 37925449
Hearing Loss	Associate	19482502
Heart Failure	Associate	23640436, 31196146, 32460775, 33518662, 35645616
Helicobacter Infections	Stimulate	15188501
Hemangiosarcoma	Associate	20008140, 20949568, 21909081, 22383169, 24091875, 26440310, 26632799, 31243333, 31805975, 32123305, 33016928, 34165212, 37350195
Hemangiosarcoma	Stimulate	24983371
Hematologic Neoplasms	Associate	10339499, 16855632, 1954386, 23237561, 29462755, 33170359, 36536122, 36792656, 38223598, 6330529
Hemimegalencephaly	Associate	16196383
Hemochromatosis type 4	Associate	19846751
Hemolytic Uremic Syndrome	Associate	23809614
Hemorrhage	Stimulate	36088477
Hepatitis B	Associate	23555992, 26916070, 27750045, 29209623, 29523126, 31739577
Hepatitis C	Associate	15133472, 16610058, 29118118, 7812011
Hepatitis C	Stimulate	37973687
Hepatoblastoma	Associate	21059911, 33368532
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12032322, 17908964, 21514380, 23468463, 25639871, 27782108, 29125598, 30394935, 32810332, 36368728
Hereditary leiomyomatosis and renal cell cancer	Associate	16960154, 33528622, 8385158
Hereditary leiomyomatosis and renal cell cancer	Inhibit	36455002
Hereditary pancreatitis	Associate	20737197
Histiocytoma Malignant Fibrous	Associate	2496060
HIV Infections	Associate	17670825, 19336959, 7604036, 8386027
HIV Infections	Stimulate	25589617
Hodgkin Disease	Associate	22955914, 25232062, 28432871, 35205272, 8385158
Hodgkin Disease	Inhibit	27708232
HTLV I Infections	Associate	17670825
Hydatidiform Mole	Associate	28713902
Hyperammonemia	Associate	28270654
Hypereosinophilic Syndrome	Associate	8364980
Hyperlipoproteinemia Type II	Associate	20613634
Hypermethioninemia	Associate	38003292
Hyperplasia	Associate	24913829, 32187665, 35878052, 37302654
Hypersensitivity Immediate	Associate	14966904, 39369230
Hypertension	Associate	36473131
Hypertrophy	Associate	30360984, 37409959
Hypomagnesemia primary	Associate	30632221, 40335697
Hypopharyngeal Neoplasms	Associate	29790697
Hypothyroidism Congenital Nongoitrous 2	Stimulate	26198055
Hypoxia	Associate	18087215, 19652553, 21712410, 22302044, 26919708, 27119353, 28978620, 31765939, 35013227
Hypoxia	Inhibit	18616527, 19596041, 20412594, 27793037, 30856376
Hypoxia	Stimulate	27656836, 28463531, 36068586
Hypoxia Brain	Associate	16543245, 21795698, 22225880, 22448750, 23082872, 28463531, 33469161
Hypoxia Brain	Stimulate	27793037
Idiopathic Pulmonary Fibrosis	Associate	27362652, 36601116
Idiopathic Pulmonary Fibrosis	Inhibit	36578501
Immunoglobulin Light chain Amyloidosis	Inhibit	37381778
Immunologic Deficiency Syndromes	Associate	39708522
Infections	Associate	29078819, 3032447
Inferior Wall Myocardial Infarction	Associate	29903764
Inflammation	Associate	1612482, 26919708, 30787124, 31284776, 31972160, 32549759, 33029691, 35120617, 36601116, 36803548, 36857629, 37588593, 40216980
Inflammation	Inhibit	24039874, 40311680
Inflammation	Stimulate	33417873
Inflammatory Bowel Diseases	Associate	1612482
Inflammatory Breast Neoplasms	Associate	22666420, 31854063, 32423453
Insulin Resistance	Associate	24512691
Intellectual Disability	Associate	24499724
Intervertebral Disc Degeneration	Inhibit	35266272
Intestinal Diseases	Stimulate	14966904, 15188501
Intestinal Diseases	Associate	22768805
Intestinal Neoplasms	Associate	20841488, 30624523
Intestinal Polyposis	Associate	36029197
Ischemia	Associate	28362162
Jacobsen Distal 11q Deletion Syndrome	Associate	30567752
Keloid	Associate	36333840
Keratoacanthoma	Associate	36051475
Kidney Diseases	Associate	15208647, 33551436
Kidney Failure Chronic	Associate	30212930
Kidney Neoplasms	Associate	18544564, 21330408, 27774982, 32826868, 35108425, 37481674, 3803604
Klatskin Tumor	Associate	26972709, 31248836
Kotzot Richter syndrome	Associate	26261666, 26916070
Laryngeal Neoplasms	Associate	14562369, 22672838, 24563233, 27072211
Laurin Sandrow syndrome	Associate	32791233
Leiomyoma	Stimulate	31761932
Leiomyoma	Associate	7997802
Leiomyosarcoma	Associate	19633646, 21192842, 37175660
Lesch Nyhan Syndrome	Associate	35534379
Leukemia	Associate	10494147, 10918054, 10936867, 11070348, 11369651, 12855588, 1451597, 15528212, 15589822, 1646047, 16855632, 16955462, 17352239, 1747869, 17646409 View all (57 more)
Leukemia	Stimulate	6330529
Leukemia B Cell	Associate	17353367, 20402410, 20823132, 22779071, 23449635, 23957733, 23995111, 25595783, 2682663, 27799566, 29118124, 3013623, 3194416, 38538317, 9395180
Leukemia Biphenotypic Acute	Associate	15098014, 2052620, 25193702, 27317766, 3013623, 32266878, 35484682, 37767562
Leukemia Biphenotypic Acute	Stimulate	26514491
Leukemia Erythroblastic Acute	Associate	29022893
Leukemia Large Granular Lymphocytic	Associate	29148541
Leukemia Lymphocytic Chronic B Cell	Associate	12586635, 18752589, 20487546, 20668475, 2070052, 20817072, 21478095, 22086413, 22623730, 23047824, 23936412, 24421328, 24578014, 24783269, 2496772 View all (21 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	23560086, 28974238
Leukemia Lymphoid	Associate	3496359
Leukemia Lymphoma Adult T Cell	Associate	16603085, 29462755, 29720732, 31628193, 31972002, 8392399
Leukemia Megakaryoblastic Acute	Stimulate	16492768
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	11238126, 17284533, 18534064, 21460180, 21693596, 24970385, 25180182, 25647305, 27573699, 27825294, 28533480, 29934492, 30049824, 30153828, 31646577, 32517078, 35528614, 37864206 View all (3 more)
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	15528212, 16293596
Leukemia Myeloid	Stimulate	1472633, 19137012, 26545364
Leukemia Myeloid	Associate	1743296, 30049824
Leukemia Myeloid Acute	Associate	11238126, 11380393, 1371419, 17046567, 18206725, 1967953, 23236401, 24200998, 24285714, 24677544, 24855276, 25006129, 25127121, 25605370, 25890196 View all (38 more)
Leukemia Myeloid Acute	Inhibit	11698483
Leukemia Myeloid Acute	Stimulate	26517351, 3513178
Leukemia Myelomonocytic Acute	Associate	10936867
Leukemia Myelomonocytic Chronic	Associate	32763828
Leukemia Myelomonocytic Juvenile	Associate	31657576
Leukemia Plasma Cell	Associate	24844357
Leukemia Prolymphocytic	Associate	1680497
Leukemia Prolymphocytic B Cell	Associate	25501113, 31527074
Leukemia Prolymphocytic T Cell	Associate	1680497, 18477041, 26466571, 3106089, 31216925
Leukemia Promyelocytic Acute	Associate	17913706, 19408305, 2189894, 2435730, 26545364, 2684961, 27010069, 27486764, 2998760, 3277186, 3422230, 34404765, 3540012, 36536122, 39999580, 8243649 View all (1 more)
Leukemia T Cell	Associate	19602047, 2312171, 27841290, 2834731, 3194416, 32659596, 3517860, 6716380, 8408711
Leukoplakia Oral	Associate	35488777
Lewy Body Disease	Inhibit	35283023
Li Fraumeni Syndrome	Associate	36514176, 7779715
Limb girdle muscular dystrophy type 2A	Associate	19015733
Liposarcoma	Associate	25622542, 36514176
Liposarcoma Myxoid	Associate	36514176
Liver Cirrhosis Biliary	Stimulate	11559656
Liver Diseases	Associate	19276364, 31292535, 31772606
Liver Failure	Associate	29690860, 35338348
Liver Neoplasms	Associate	20380719, 21059911, 26810065, 30378283, 30944375, 36896891, 37053209
Lung Diseases	Associate	32457348
Lung Neoplasms	Associate	12378599, 12876208, 1306309, 15210690, 1645569, 16790082, 19547694, 22363436, 22693540, 23365639, 23776433, 24132637, 25299775, 25895136, 26035432 View all (37 more)
Lupus Erythematosus Systemic	Associate	2056195, 26175399, 2776356, 3311495
Lupus Erythematosus Systemic	Stimulate	3701256
Lupus Erythematosus Systemic	Inhibit	9822266
Lymphatic Diseases	Associate	26916070
Lymphatic Metastasis	Associate	17278192, 23717612, 24053468, 25840688, 28671049, 29984790, 31870116, 36999462, 38065972, 7903963
Lymphatic Metastasis	Stimulate	24488669, 29364480, 32297641
Lymphedema	Associate	20008140
Lymphoma	Associate	10706881, 11904304, 12594230, 12670331, 14592832, 15150404, 16258503, 1638027, 16418334, 16507780, 18645192, 19022773, 19106104, 19535347, 19597184 View all (123 more)
Lymphoma	Stimulate	23573174, 24943107, 30610086
Lymphoma AIDS Related	Associate	11163079, 1472633, 2840989, 39324141
Lymphoma B Cell	Associate	10323217, 10520030, 11163079, 1485535, 15191563, 15787160, 15842661, 16258503, 16848772, 17093053, 1713514, 19091460, 19597184, 20118770, 20348878 View all (105 more)
Lymphoma B Cell	Stimulate	16418334, 32362635
Lymphoma B Cell Marginal Zone	Associate	17197434, 21460242, 2200538, 25337204, 26763367, 37941429
Lymphoma Follicular	Associate	12077300, 14508797, 1485535, 1638027, 19597184, 22168746, 24388756, 26464726, 27117536, 27390358, 28984304, 29793519, 30012920, 30213873, 31844144 View all (6 more)
Lymphoma Large B Cell Diffuse	Associate	12077300, 12562237, 12594230, 16258503, 1671647, 16760443, 16848772, 17197434, 17951530, 18024371, 1824261, 18287131, 18477041, 18493992, 18544678 View all (187 more)
Lymphoma Large B Cell Diffuse	Stimulate	21460242, 25589617, 36112929
Lymphoma Large B Cell Diffuse	Inhibit	27708232
Lymphoma Large Cell Anaplastic	Associate	12213716, 16955462, 18085637, 21080342, 23411487, 27793034, 29609590, 31101622, 32587329, 34131801, 37762644, 8204884
Lymphoma Large Cell Immunoblastic	Stimulate	2436688
Lymphoma Large Cell Immunoblastic	Associate	7812011, 8380252
Lymphoma Mantle Cell	Associate	11722412, 12580957, 15718413, 16409295, 16434369, 19594747, 22002311, 22259787, 23640973, 23926923, 26022239, 26517511, 26873538, 32273477, 32584970, 33528622, 34882582, 37598282 View all (3 more)
Lymphoma Mantle Cell	Stimulate	12472567
Lymphoma Non Hodgkin	Associate	11343379, 12714522, 12745652, 1311213, 19048401, 20614267, 21956115, 24578014, 24733537, 25070240, 2509518, 27049262, 2840989, 30872592, 3128772 View all (17 more)
Lymphoma Primary Effusion	Associate	29954751, 32817485, 33298918, 33411730, 34857874, 36012375
Lymphoma T Cell	Associate	15656903, 18085637, 30020405, 34088321, 34967583, 35708139, 35878052, 35882439
Lymphoma T Cell Cutaneous	Associate	19211505, 32286303, 33333886, 9864169
Lymphoma T Cell Cutaneous	Stimulate	35247891
Lymphoma T Cell Peripheral	Associate	30782609, 34742294
Lymphomatoid Papulosis	Associate	20346172
Lymphoproliferative Disorders	Associate	11896204, 34511544, 3491176
Lysosomal Storage Diseases	Associate	35351824
malar prominence	Associate	23901000
Malaria	Stimulate	25099163
Malaria Falciparum	Associate	40085439
Malformations of Cortical Development Group I	Associate	18682607, 24675470, 8142255, 9354939
Malnutrition	Stimulate	26646563
Mandibular Nerve Injuries	Associate	35892263
MASS syndrome	Associate	32843454
Medulloblastoma	Associate	11770900, 11916498, 11958658, 17254356, 17465989, 18059365, 18593994, 19134217, 19584924, 19594892, 20921458, 21098324, 21324178, 21793975, 22016811 View all (39 more)
Melanoma	Associate	11139316, 11250904, 12721301, 12824159, 15153331, 15221868, 17218782, 18677108, 18679422, 19421315, 19898689, 19934275, 20499280, 2121834, 21497295 View all (18 more)
Melanoma	Inhibit	25444926
Melanoma	Stimulate	31820036
Melanoma Amelanotic	Associate	22555175
Melanoma Cutaneous Malignant	Stimulate	10209447
Melanoma Cutaneous Malignant	Associate	11139316, 17094481, 38615585
Meningeal Carcinomatosis	Associate	12378623
Meningioma	Associate	18808065, 27007654, 32832554, 8343222
Mesothelioma	Associate	24598211
Mesothelioma Malignant	Associate	24926545, 27705913
Metaplasia	Stimulate	12508351
Methylcobalamin Deficiency CblG Type	Associate	38035708
Microsatellite Instability	Associate	17297307
Microvascular Angina	Associate	39176099
Midline granulomatosis	Associate	23604113
Mitochondrial Diseases	Associate	22084162, 27789709
Mitochondrial Diseases	Stimulate	34646389
Mitochondrial encephalopathy	Associate	27345796
Monoclonal Gammopathy of Undetermined Significance	Associate	10614712
Mouth Diseases	Associate	19200988, 21556123
Mouth Diseases	Stimulate	37656618
Mouth Neoplasms	Associate	21292635, 21795698, 23552692, 36012403
Mucopolysaccharidosis VI	Associate	38006675
Multiple Endocrine Neoplasia Type 2a	Associate	35361013
Multiple Myeloma	Associate	10618400, 1415486, 14531906, 15491286, 16497877, 18381641, 18641367, 18647998, 19074889, 19144381, 19395026, 19454499, 2070052, 20974848, 21223249 View all (71 more)
Multiple Myeloma	Stimulate	19636021, 7742531
Multiple Myeloma	Inhibit	27738323
Multiple Sclerosis	Associate	30463275, 31212712, 37236124
Multiple Sclerosis Relapsing Remitting	Associate	31212712
Muscular Atrophy	Associate	30360984
Muscular dystrophy congenital with central nervous system involvement	Associate	28209136
Muscular Dystrophy Facioscapulohumeral	Associate	28273136
Myasthenia Gravis	Associate	33510225
Myasthenia Gravis	Stimulate	8286826
Mycoses	Associate	39522754
Mycosis Fungoides	Associate	27473081
Myelodysplastic Syndromes	Associate	11722413, 26382622, 28539603, 34749168, 8943864
Myelodysplastic Syndromes	Stimulate	22524974
Myocardial Infarction	Stimulate	28972002
Myoclonic Epilepsies Progressive	Associate	31374462
Myoepithelioma	Associate	25223915
Myofibrillar Myopathy	Associate	37748332
Myopathy with Giant Abnormal Mitochondria	Associate	27119353
Myopia	Associate	35586671
Myositis Ossificans	Associate	37307755
Myostatin related muscle hypertrophy	Associate	29505605
Myotonic Dystrophy	Associate	24027017
Mysophobia	Associate	24036151
Nasopharyngeal Carcinoma	Associate	19698176, 20440510, 22588558, 23601184, 24157866, 24814906, 26993269, 30141114, 30226609, 30718276, 31703161, 32767326, 32964977, 32985354, 35441564 View all (4 more)
Native American myopathy	Associate	34529278
Necrosis	Associate	22084162
Neoplasm Invasiveness	Associate	12237776, 12657136, 21556123, 27784970, 7679417
Neoplasm Metastasis	Associate	11139316, 11706062, 1309531, 16886612, 17088530, 17158641, 17278192, 19633646, 19653714, 20133671, 21553350, 21575199, 22056952, 22321834, 22666420 View all (56 more)
Neoplasm Metastasis	Inhibit	26538417
Neoplasm Metastasis	Stimulate	31239274, 32198408
Neoplasm Recurrence Local	Associate	10604737, 34326338
Neoplasms	Associate	10209447, 10323217, 10339499, 10556095, 10576148, 10618400, 10702403, 10705309, 10706881, 11115495, 11139316, 11163079, 11239393, 11250904, 11449404 View all (813 more)
Neoplasms	Inhibit	11158583, 16537449, 17553155, 18719378, 18763282, 19066217, 20007697, 21998677, 26915294, 27409345, 27708232, 28187036, 31822509, 33921161, 34117747 View all (7 more)
Neoplasms	Stimulate	15082903, 15188501, 15526354, 16179497, 17192266, 17210682, 19064714, 21297939, 21696634, 22588558, 23034332, 24282295, 24618292, 26320455, 26514491 View all (18 more)
Neoplasms Cystic Mucinous and Serous	Associate	2921356
Neoplasms Cystic Mucinous and Serous	Stimulate	35002543
Neoplasms Germ Cell and Embryonal	Associate	38430549
Neoplasms Glandular and Epithelial	Associate	36535331
Neoplasms Multiple Primary	Associate	21102417
Neoplasms Radiation Induced	Associate	36788076
Neoplasms Squamous Cell	Associate	1430259, 22500694, 32867570, 36289203
Neoplasms Unknown Primary	Associate	29973234
Nerve Degeneration	Associate	22005580
Neural Tube Defects	Associate	31357093
Neuralgia	Associate	34741226, 35892263
Neuraminidase 1 deficiency	Stimulate	25115389
Neurilemmoma	Stimulate	22247700
Neurilemmoma	Associate	33222917
Neuroblastoma	Associate	12553908, 15382088, 18780787, 20101214, 21109931, 2123747, 22623531, 23091029, 23175188, 23601184, 24173829, 25017515, 25292042, 25896758, 26035700 View all (30 more)
Neurodegenerative Diseases	Associate	16805856, 22005580, 37796681
Neuroectodermal Tumors Primitive	Associate	18452568, 19725831
Neuroectodermal Tumors Primitive Peripheral	Associate	10882752
Neuroendocrine Tumors	Associate	25299775, 32200350, 33514539, 37116859, 37491889, 38330136
Neurofibrosarcoma	Associate	10470286, 23437333
Neuronal intranuclear inclusion disease	Associate	35772299
Neurotoxicity Syndromes	Stimulate	22005580
Niemann Pick Disease Type C	Associate	24044630, 24367666, 33099109
NOG Related Symphalangism Spectrum Disorder	Associate	15750208
Non alcoholic Fatty Liver Disease	Associate	36473131, 36587184
Non Muscle Invasive Bladder Neoplasms	Associate	26046361, 36430344, 8104920
Non Muscle Invasive Bladder Neoplasms	Stimulate	31316092
Noonan Syndrome	Associate	31657576
Obesity	Associate	34214899, 36473131
Oligodendroglioma	Associate	29489901
Olivopontocerebellar Atrophies	Associate	22301348
Oncogene Addiction	Stimulate	23071356
Oncogene Addiction	Inhibit	34493659
Oncogene Addiction	Associate	36581205
Optic Nerve Glioma	Associate	11381677
Organizing Pneumonia	Associate	34062284
Ornithine Carbamoyltransferase Deficiency Disease	Associate	33550136
Orofacial Cleft 1	Associate	30254216
Osseous Heteroplasia Progressive	Associate	36803548
Ossification Heterotopic	Associate	36803548
Osteoarthritis	Associate	29806631, 30081074, 32144293, 36619785, 38090564, 38401067, 39738612
Osteosarcoma	Associate	18385200, 22037351, 24014087, 24835790, 24942472, 2496060, 25025684, 25546234, 28081736, 28539830, 28924385, 29502343, 29630434, 30902071, 33563042 View all (13 more)
Osteosarcoma	Inhibit	31397185
Osteosarcoma	Stimulate	33125136
Ovarian Diseases	Associate	23006437, 37598177
Ovarian Neoplasms	Associate	10549271, 11158614, 12853350, 15132769, 1637683, 17908964, 19147754, 20852632, 2205100, 22951414, 23029531, 23133607, 23919393, 25143136, 26320455 View all (32 more)
Ovarian Neoplasms	Inhibit	36510984
Pagetoid Reticulosis	Stimulate	29760516
Pain	Associate	35892263
Pancreatic Neoplasms	Associate	15810077, 16874304, 17496331, 21573184, 22670178, 24392017, 24551298, 25347153, 25807524, 26021472, 26046375, 26108419, 27517489, 27579533, 30932257 View all (26 more)
Pancreatitis	Associate	32549759, 37063434
Pancreatitis Chronic	Associate	17496331
Pancreatitis Chronic	Stimulate	40216980
Papillomavirus Infections	Associate	16378632
Paragangliomas 3	Associate	31996670, 37599362
Paraplegia	Stimulate	15308563
Parkinson Disease	Associate	34204164
Paroxysmal nonkinesigenic dyskinesia	Associate	9192778
Pediatric Obesity	Associate	32011831
Pelvic Inflammatory Disease	Associate	34445161
Pelvic Inflammatory Disease	Stimulate	36196757
Penile Neoplasms	Associate	35806108
Peripheral Vascular Diseases	Associate	26662105
Peritoneal Neoplasms	Associate	31171626, 38226984
Persistent Mullerian duct syndrome	Associate	37488307
Personality Disorders	Associate	16886612, 2200538, 28463958, 28984200, 29295717, 32410663, 33374332, 33969640, 38423596, 39375391
Pheochromocytoma	Associate	15796198
Pinealoma	Associate	31768671, 31820118, 33619588
Pituitary Neoplasms	Associate	35247260, 39290194, 8943742
Placenta Diseases	Associate	34220309
Plasmablastic Lymphoma	Associate	16258503, 17405744, 20348878, 20348882, 20614267, 20962620, 23599149, 25634193, 26108914, 27175027, 27687004, 30012920, 32118627, 32273478, 33297669, 33951889, 37105495 View all (2 more)
Plasmacytoma	Associate	10618400, 2470097, 32321465, 3464006, 35650679
Pleural Diseases	Associate	36161776
Pneumonia	Associate	24132637
Polycystic Kidney Autosomal Dominant	Associate	18755075
Polyps	Associate	21892521
Post Infectious Disorders	Associate	31243333
Precancerous Conditions	Associate	1653781, 22768805, 37105989
Precancerous Conditions	Stimulate	17032497, 33859744
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	14521459, 29112016, 29943642, 31127282, 31776129, 3186743, 32011831, 3520570, 38175445
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	14508797, 16855632, 18618503, 21242186, 22547686, 22563559, 22779071, 2320412, 23276184, 23494176, 2432398, 25270907, 26517351, 29367285, 29462755 View all (11 more)
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	11722413
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12087466, 17114293, 19436302, 20618946, 21527520, 24952875, 25270907, 26517351, 27705940, 29023469, 34396983, 35001521, 35210568, 35245453, 35488386 View all (4 more)
Prodromal Symptoms	Associate	31945157, 32877461
Progressive Transformation of Germinal Centers	Associate	18024371, 22929980, 25193962
Prolactinoma	Associate	8943742
Prostate Cancer Hereditary 7	Associate	25131421, 33903734
Prostatic Hyperplasia	Associate	10705309, 16309180, 16827116, 29234244
Prostatic Neoplasms	Associate	10705309, 12000731, 12185081, 14997205, 15314206, 15781629, 16449206, 18350153, 18567993, 18623111, 18670647, 18752058, 19164469, 19276271, 19343732 View all (113 more)
Prostatic Neoplasms	Stimulate	18190704, 28592290
Prostatic Neoplasms	Inhibit	40362536
Prostatic Neoplasms Castration Resistant	Associate	14660748, 21975934, 23704919, 24475272, 25201220, 25875826, 29415999, 30620391, 30846826, 34716314, 35943799, 36629431, 36877164
Prostatic Neoplasms Castration Resistant	Stimulate	26056150
Prostatitis	Associate	10705309, 11005213, 1373070, 14997205, 15712208, 15781629, 16309180, 16827116, 17146477, 18190704, 18350153, 18567993, 18670647, 19773438, 20634801 View all (10 more)
Prosthesis Failure	Associate	25347153
Pseudolymphoma	Associate	2540855, 9610616
Pulmonary Arterial Hypertension	Associate	36514015
Pulmonary Disease Chronic Obstructive	Associate	31829519, 32565880, 32982206, 35438040
Pyruvate Carboxylase Deficiency Disease	Associate	28463531, 31213128, 36752202
Radiation Injuries	Associate	31805975
Recombinant chromosome 8 syndrome	Associate	35864546
Rectal Neoplasms	Associate	16397240, 25380052, 27784970, 29119627, 29475734, 34642262, 34706519, 8376401
Reproductive Tract Infections	Associate	19114327
Respiratory Distress Syndrome	Associate	31566109
Retinal Dysplasia	Associate	17549669, 24853183, 2631744, 26926447, 35897137
Retinal Dysplasia	Stimulate	37656618
Retinitis Pigmentosa	Associate	23197854, 28677533
Retinoblastoma	Associate	28888422, 31184221
Rett Syndrome	Associate	21807996, 38100910
Rhabdoid Tumor	Associate	20212451, 23764045, 31708418, 38040699
Rhabdoid Tumor Predisposition Syndrome 1	Associate	34165212
Rhabdomyosarcoma	Associate	16899113, 34697065, 35408939, 8471424
Rufous oculocutaneous albinism	Associate	34668039
Salivary Duct Calculi	Associate	32457410
Sarcoma	Associate	24947144, 25984907, 35069780, 39491746
Sarcoma Ewing	Inhibit	39201282
Sarcoma Ewing	Stimulate	8164678
Sarcoma Kaposi	Associate	34728235, 37032379, 8952524
Sarcoma Myeloid	Associate	24844357
Schistosomiasis	Associate	16308474, 32297641
Sebaceous Gland Neoplasms	Associate	34445161
Seminoma	Associate	32615059, 4027160
Sepsis	Associate	31566109
Sertoli Cell Only Syndrome	Associate	27773559, 30523716, 39375391
Short Stature Idiopathic X Linked	Associate	33008815
Shwachman Diamond Syndrome	Associate	26762974
Sick Sinus Syndrome	Associate	26046361
Simpson Golabi Behmel syndrome	Associate	38141607
Skin Neoplasms	Associate	21497295
Skin Neoplasms	Stimulate	32283126
Sleep Deprivation	Associate	9824682
Small Cell Lung Carcinoma	Associate	12553908, 15665467, 15665468, 1645569, 20615970, 23035247, 23716474, 24058603, 2456019, 25122428, 25495526, 25884680, 26683772, 26772203, 27105536 View all (22 more)
Small Cell Lung Carcinoma	Inhibit	2842776
Soft Tissue Injuries	Associate	19633646
Spastic paraplegia 11 autosomal recessive	Associate	12237776
Splenomegaly	Associate	26517351, 26916070
Spondylitis Ankylosing	Associate	36803548
Squamous Cell Carcinoma of Head and Neck	Associate	20927317, 21853135, 21998677, 22330139, 2502519, 26506880, 26515287, 28671055, 29385191, 29900911, 30143678, 30341788, 31570856, 32424132, 32716971 View all (10 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	27567435
Squamous Intraepithelial Lesions	Associate	11906549, 23408758
Status Asthmaticus	Associate	30068332
Stomach Diseases	Associate	15188501, 21528007, 22442341, 32102509
Stomach Neoplasms	Associate	10027304, 10576148, 14562369, 14606069, 15188501, 15526354, 16309200, 16475731, 16609989, 16886612, 17036397, 17431415, 19084934, 19596917, 19697059 View all (59 more)
Stomach Neoplasms	Stimulate	24668547
Subarachnoid Hemorrhage	Associate	29884860
Sveinsson Chorioretinal Atrophy	Associate	34493366
Synovitis	Associate	12130502
Tarlov Cysts	Stimulate	22670178
Tarlov Cysts	Associate	39230995
Telomeric 22q13 Monosomy Syndrome	Associate	12824159
Telomeric 22q13 Monosomy Syndrome	Stimulate	27503890
Teratoid Tumor Atypical	Associate	31708418
Tertiary Lymphoid Structures	Associate	17094481, 29984790
Testicular Germ Cell Tumor	Associate	32615059
Testicular Neoplasms	Associate	33311588, 3964537, 4027160
Thymic epithelial tumor	Associate	34530916
Thymoma	Associate	30787364
Thymus Neoplasms	Associate	28506304
Thyroid cancer medullary	Associate	3855302, 9626044
Thyroid Cancer Papillary	Associate	28277188, 30531691, 32198408, 34628367, 34723715, 37750019
Thyroid Carcinoma Anaplastic	Associate	30758123
Thyroid Neoplasms	Associate	28974238, 3005035, 30768848, 32198408, 3348948, 36362068
Thyroiditis	Associate	19084934, 2803926
Tissue Adhesions	Associate	37385390
Tongue Neoplasms	Associate	28623290
Triple Negative Breast Neoplasms	Associate	24096545, 25870263, 25953261, 26939876, 26950360, 27208794, 28427212, 28817737, 29475913, 30108112, 30324719, 30704524, 31577739, 31905596, 31942031 View all (20 more)
Triple Negative Breast Neoplasms	Stimulate	31836816
Trisomy	Associate	25270907
Tuberculosis Extrapulmonary	Associate	34967583
Tuberculosis Multidrug Resistant	Associate	20663232, 21514380
Tukel syndrome	Inhibit	28423716
Typical Teratoid Rhabdoid Tumor	Associate	27380723, 29428974, 33737307, 33938067, 34145313, 34235002, 35501487, 35804041, 37450044
Urachal adenocarcinoma	Associate	36670542
Urea Cycle Disorders Inborn	Associate	28270654
Urethral Neoplasms	Associate	18639569, 19087307, 29312470
Urinary Bladder Neoplasms	Associate	12237776, 18794855, 19682434, 2125987, 22361733, 23284801, 23624844, 25536625, 26046361, 27456363, 27906180, 28151475, 28720065, 29463565, 30229818 View all (14 more)
Urogenital Neoplasms	Associate	19087307
Usher Syndrome Type IG	Associate	31844144
Uterine Cervical Dysplasia	Associate	11906549, 1752978, 19373808, 22500694, 24662128, 25596731, 31771040, 7679417
Uterine Cervical Neoplasms	Associate	12366664, 16378632, 1653781, 1683873, 19596931, 21556123, 22500694, 24662128, 27166252, 27492148, 27835890, 29525942, 29989647, 30018982, 3029760 View all (6 more)
Uterine Cervical Neoplasms	Stimulate	27556514
Uterine Cervicitis	Associate	11906549, 18782427, 32843454
Uveal melanoma	Associate	10209447, 15548813, 19653714, 31848373, 7573354, 7622289
Vascular Diseases	Associate	19729955, 24039874
Venous Thromboembolism	Associate	33388092
Ventricular Remodeling	Associate	34939316
Virus Diseases	Associate	9653139
Vitamin D Deficiency	Associate	15750208, 26931436
Waldenstrom Macroglobulinemia	Associate	28771100
Weight Loss	Associate	27524493
Werner Syndrome	Associate	12842909
Wilms Tumor	Associate	30178838
Wounds and Injuries	Associate	29158265
X Linked Combined Immunodeficiency Diseases	Associate	27080984

MYC (MYC proto-oncogene, bHLH transcription factor)