Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4605
Gene name Gene Name - the full gene name approved by the HGNC.
MYB proto-oncogene like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYBL2
Synonyms (NCBI Gene) Gene synonyms aliases
B-MYB, BMYB
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006045 hsa-miR-30e-5p Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot 21187425
MIRT006045 hsa-miR-30e-5p Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot 21187425
MIRT006045 hsa-miR-30e-5p Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot 21187425
MIRT021213 hsa-miR-149-3p Reporter assay;Western blot;qRT-PCR 20623644
MIRT049701 hsa-miR-92a-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 14618416;16299810
MYBL2 Unknown 15922873
MYCN Activation 21304178
SP1 Unknown 15922873
TFDP1 Activation 14618416
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10770937
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601415 7548 ENSG00000101057
Protein
UniProt ID P10244
Protein name Myb-related protein B (B-Myb) (Myb-like protein 2)
Protein function Transcription factor involved in the regulation of cell survival, proliferation, and differentiation. Transactivates the expression of the CLU gene.
PDB 6C48
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13921 Myb_DNA-bind_6 34 94 Domain
PF00249 Myb_DNA-binding 135 180 Myb-like DNA-binding domain Domain
PF09316 Cmyb_C 451 607 C-myb, C-terminal Family
Sequence
MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASH
FPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKV
IELVKKYGTKQWTLIAKHLKGRLGKQ
CRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTI
KRKVDTGGFLSESKDCKPPVYLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEEN
SEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQEGSPPETSLPYKWVVEAANLL
IPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQASHQQQVLPPRQ
PSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL
SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCS
QKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPH
LEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMS
TLPKSLS
LPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMS
SAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
Sequence length 700
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cellular senescence   Polo-like kinase mediated events
TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 36803948
Adenocarcinoma of Lung Associate 31758653, 32925947, 37752167
Astrocytoma Associate 36115056
Breast Neoplasms Associate 19043454, 20864510, 24349128, 26510790, 28061449, 28276478, 28697743, 29268817, 30358191, 32925947, 34585645, 34588717, 35341461
Breast Neoplasms Stimulate 31280346, 35135230
Calcinosis Cutis Stimulate 33897882
Calcinosis Cutis Associate 36087093
Carcinogenesis Associate 24289849, 28555007, 30321399, 33765507, 39766782
Carcinoma Ductal Stimulate 33335279
Carcinoma Hepatocellular Associate 24349128, 31737652, 34585645, 35135230, 35176941, 36494680, 36685007