Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4605
Gene name	MYB proto-oncogene like 2
Gene symbol	MYBL2
Synonyms (NCBI Gene)	B-MYBBMYB
Chromosome	20
Chromosome location	20q13.12
Summary	The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006045	hsa-miR-30e-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21187425
MIRT006045	hsa-miR-30e-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21187425
MIRT006045	hsa-miR-30e-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21187425
MIRT021213	hsa-miR-149-3p	Reporter assay;Western blot;qRT-PCR	20623644
MIRT049701	hsa-miR-92a-3p	CLASH	23622248
MIRT041019	hsa-miR-505-3p	CLASH	23622248
MIRT038033	hsa-miR-423-5p	CLASH	23622248
MIRT437542	hsa-miR-19b-3p	Immunoprecipitaion	22382630
MIRT727125	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727124	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727123	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727122	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT006045	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT021213	hsa-miR-149-3p	PAR-CLIP	27292025
MIRT038033	hsa-miR-423-5p	PAR-CLIP	27292025
MIRT736221	hsa-miR-29b-2-5p	RNA-seqqRT-PCR	33808771
MIRT1167644	hsa-miR-1205	CLIP-seq
MIRT1167645	hsa-miR-1207-3p	CLIP-seq
MIRT1167646	hsa-miR-1286	CLIP-seq
MIRT1167647	hsa-miR-1291	CLIP-seq
MIRT1167648	hsa-miR-138	CLIP-seq
MIRT1167649	hsa-miR-146b-3p	CLIP-seq
MIRT1167650	hsa-miR-29a	CLIP-seq
MIRT1167651	hsa-miR-29b	CLIP-seq
MIRT1167652	hsa-miR-29c	CLIP-seq
MIRT1167653	hsa-miR-30a	CLIP-seq
MIRT1167654	hsa-miR-30b	CLIP-seq
MIRT1167655	hsa-miR-30c	CLIP-seq
MIRT1167656	hsa-miR-30d	CLIP-seq
MIRT1167657	hsa-miR-30e	CLIP-seq
MIRT1167658	hsa-miR-3152-5p	CLIP-seq
MIRT1167659	hsa-miR-3184	CLIP-seq
MIRT1167660	hsa-miR-328	CLIP-seq
MIRT1167661	hsa-miR-3607-3p	CLIP-seq
MIRT1167662	hsa-miR-3613-3p	CLIP-seq
MIRT1167663	hsa-miR-3663-3p	CLIP-seq
MIRT1167664	hsa-miR-378g	CLIP-seq
MIRT1167665	hsa-miR-4423-5p	CLIP-seq
MIRT1167666	hsa-miR-4436b-3p	CLIP-seq
MIRT1167667	hsa-miR-4437	CLIP-seq
MIRT1167668	hsa-miR-4632	CLIP-seq
MIRT1167669	hsa-miR-4674	CLIP-seq
MIRT1167670	hsa-miR-4717-3p	CLIP-seq
MIRT1167671	hsa-miR-4722-5p	CLIP-seq
MIRT1167672	hsa-miR-4733-3p	CLIP-seq
MIRT1167673	hsa-miR-4792	CLIP-seq
MIRT1167674	hsa-miR-501-3p	CLIP-seq
MIRT1167675	hsa-miR-502-3p	CLIP-seq
MIRT1167676	hsa-miR-580	CLIP-seq
MIRT1167677	hsa-miR-590-3p	CLIP-seq
MIRT1167678	hsa-miR-665	CLIP-seq
MIRT1167679	hsa-miR-767-5p	CLIP-seq
MIRT1167680	hsa-miR-939	CLIP-seq
MIRT2048361	hsa-miR-1182	CLIP-seq
MIRT2048362	hsa-miR-1273f	CLIP-seq
MIRT2048363	hsa-miR-143	CLIP-seq
MIRT2048364	hsa-miR-1913	CLIP-seq
MIRT2048365	hsa-miR-27a	CLIP-seq
MIRT2048366	hsa-miR-27b	CLIP-seq
MIRT1167650	hsa-miR-29a	CLIP-seq
MIRT1167651	hsa-miR-29b	CLIP-seq
MIRT1167652	hsa-miR-29c	CLIP-seq
MIRT1167653	hsa-miR-30a	CLIP-seq
MIRT1167654	hsa-miR-30b	CLIP-seq
MIRT1167655	hsa-miR-30c	CLIP-seq
MIRT1167656	hsa-miR-30d	CLIP-seq
MIRT1167657	hsa-miR-30e	CLIP-seq
MIRT2048367	hsa-miR-324-3p	CLIP-seq
MIRT2048368	hsa-miR-331-3p	CLIP-seq
MIRT1167661	hsa-miR-3607-3p	CLIP-seq
MIRT2048369	hsa-miR-361-3p	CLIP-seq
MIRT2048370	hsa-miR-3661	CLIP-seq
MIRT1167663	hsa-miR-3663-3p	CLIP-seq
MIRT2048371	hsa-miR-4251	CLIP-seq
MIRT2048372	hsa-miR-4313	CLIP-seq
MIRT2048373	hsa-miR-4329	CLIP-seq
MIRT2048374	hsa-miR-4330	CLIP-seq
MIRT1167667	hsa-miR-4437	CLIP-seq
MIRT2048375	hsa-miR-4514	CLIP-seq
MIRT1167668	hsa-miR-4632	CLIP-seq
MIRT2048376	hsa-miR-4640-3p	CLIP-seq
MIRT2048377	hsa-miR-4645-5p	CLIP-seq
MIRT2048378	hsa-miR-4650-5p	CLIP-seq
MIRT2048379	hsa-miR-4673	CLIP-seq
MIRT1167669	hsa-miR-4674	CLIP-seq
MIRT2048380	hsa-miR-4692	CLIP-seq
MIRT2048381	hsa-miR-4701-5p	CLIP-seq
MIRT2048382	hsa-miR-4708-5p	CLIP-seq
MIRT1167672	hsa-miR-4733-3p	CLIP-seq
MIRT2048383	hsa-miR-4755-3p	CLIP-seq
MIRT2048384	hsa-miR-4770	CLIP-seq
MIRT1167673	hsa-miR-4792	CLIP-seq
MIRT2048385	hsa-miR-4795-5p	CLIP-seq
MIRT2048386	hsa-miR-513a-5p	CLIP-seq
MIRT1167676	hsa-miR-580	CLIP-seq
MIRT2048387	hsa-miR-588	CLIP-seq
MIRT2048388	hsa-miR-619	CLIP-seq
MIRT2048389	hsa-miR-631	CLIP-seq
MIRT1167678	hsa-miR-665	CLIP-seq
MIRT1167680	hsa-miR-939	CLIP-seq
MIRT2048364	hsa-miR-1913	CLIP-seq
MIRT2048365	hsa-miR-27a	CLIP-seq
MIRT2048366	hsa-miR-27b	CLIP-seq
MIRT1167653	hsa-miR-30a	CLIP-seq
MIRT1167654	hsa-miR-30b	CLIP-seq
MIRT1167655	hsa-miR-30c	CLIP-seq
MIRT1167656	hsa-miR-30d	CLIP-seq
MIRT1167657	hsa-miR-30e	CLIP-seq
MIRT2048367	hsa-miR-324-3p	CLIP-seq
MIRT1167661	hsa-miR-3607-3p	CLIP-seq
MIRT2048372	hsa-miR-4313	CLIP-seq
MIRT2048374	hsa-miR-4330	CLIP-seq
MIRT2048376	hsa-miR-4640-3p	CLIP-seq
MIRT2048386	hsa-miR-513a-5p	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
E2F1	Activation	14618416;16299810
MYBL2	Unknown	15922873
MYCN	Activation	21304178
SP1	Unknown	15922873
TFDP1	Activation	14618416

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10770937
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10770937
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	17159899, 17531812, 19725879, 25557911, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0031523	Component	Myb complex	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10770937
GO:0090307	Process	Mitotic spindle assembly	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
601415	7548	ENSG00000101057

P10244

Protein name

Myb-related protein B (B-Myb) (Myb-like protein 2)

Protein function

Transcription factor involved in the regulation of cell survival, proliferation, and differentiation. Transactivates the expression of the CLU gene.

PDB

6C48

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13921	Myb_DNA-bind_6	34 → 94		Domain
PF00249	Myb_DNA-binding	135 → 180	Myb-like DNA-binding domain	Domain
PF09316	Cmyb_C	451 → 607	C-myb, C-terminal	Family

Sequence

MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASH
FPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ
CRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTI
KRKVDTGGFLSESKDCKPPVYLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEEN
SEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQEGSPPETSLPYKWVVEAANLL
IPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQASHQQQVLPPRQ
PSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL
SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCS
QKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPH
LEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMS
TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMS
SAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

Sequence length

700

Interactions

View interactions

	KEGG		Reactome
	Cellular senescence		Polo-like kinase mediated events TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Uncertain significance	rs1361393945	RCV005926929

Show/Hide Text Mining Associations (54)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	36803948
Adenocarcinoma of Lung	Associate	31758653, 32925947, 37752167
Astrocytoma	Associate	36115056
Breast Neoplasms	Associate	19043454, 20864510, 24349128, 26510790, 28061449, 28276478, 28697743, 29268817, 30358191, 32925947, 34585645, 34588717, 35341461
Breast Neoplasms	Stimulate	31280346, 35135230
Calcinosis Cutis	Stimulate	33897882
Calcinosis Cutis	Associate	36087093
Carcinogenesis	Associate	24289849, 28555007, 30321399, 33765507, 39766782
Carcinoma Ductal	Stimulate	33335279
Carcinoma Hepatocellular	Associate	24349128, 31737652, 34585645, 35135230, 35176941, 36494680, 36685007
Carcinoma Intraductal Noninfiltrating	Inhibit	33335279
Carcinoma Non Small Cell Lung	Stimulate	28555007
Carcinoma Renal Cell	Associate	32951068
Colonic Neoplasms	Associate	34585645
Colorectal Neoplasms	Stimulate	19016757
Colorectal Neoplasms	Associate	30985693, 35135230, 37386467, 38064496
COVID 19	Associate	35995775
Diabetes Mellitus Type 1	Associate	33133095
Endometrial Neoplasms	Associate	33782625
Glioblastoma	Associate	32696617, 32974985
Glioma	Associate	28784180, 32696617, 33765507, 34585645, 36776924, 39684661
Glioma	Stimulate	36133745
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30206359
Knee Injuries	Associate	33749514
Leukemia Myeloid Acute	Associate	35135230
Lung Neoplasms	Stimulate	28555007
Lung Neoplasms	Associate	38522681
Lymphoma	Associate	12393503
Myelodysplastic Myeloproliferative Diseases	Associate	23878725
Myelodysplastic Syndromes	Inhibit	23878725
Myocardial Infarction	Stimulate	29049183
Neoplasm Metastasis	Associate	21270603, 28555007
Neoplasm Metastasis	Stimulate	33897882
Neoplasms	Associate	11071270, 19359472, 21304178, 23878725, 24289849, 24374933, 25999348, 26308378, 28276478, 28427185, 28784180, 30206359, 30224471, 30321399, 32439918 View all (10 more)
Neoplasms	Inhibit	23878725, 24639887
Neoplasms	Stimulate	28555007, 32951068
Neuroblastoma	Associate	21304178, 22619121, 28467792, 35135230, 7721753
Osteoarthritis	Associate	33749514
Ovarian Neoplasms	Associate	11071270
Pancreatic Neoplasms	Associate	35387554
Personality Disorders	Associate	30206359
Prostatic Neoplasms	Associate	33897882, 36087093
Prostatic Neoplasms Castration Resistant	Associate	21900400
Prostatic Neoplasms Castration Resistant	Stimulate	33897882
Sarcoma	Stimulate	32084007
Squamous Cell Carcinoma of Head and Neck	Associate	33787061
Stomach Neoplasms	Stimulate	34358419
Tertiary Lymphoid Structures	Stimulate	31280346
Thyroid Carcinoma Anaplastic	Associate	32887540
Triple Negative Breast Neoplasms	Associate	20864510, 33835503
Urinary Bladder Neoplasms	Associate	35135230
Uterine Cervical Dysplasia	Associate	21270603
Uterine Cervical Neoplasms	Stimulate	21270603
Uterine Cervical Neoplasms	Associate	33302814

MYBL2 (MYB proto-oncogene like 2)