Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4602
Gene name Gene Name - the full gene name approved by the HGNC.	MYB proto-oncogene, transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MYB
Synonyms (NCBI Gene) Gene synonyms aliases	Cmyb, c-myb, c-myb_CDS, efg
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein with three HTH DNA-binding domains that functions as a transcription regulator. This protein plays an essential role in the regulation of hematopoiesis. This gene may be aberrently expressed or rearranged or undergo translocati

Show/Hide all(355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Western blot	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	18667440
MIRT000747	hsa-miR-34b-5p	Review, Microarray	19461653
MIRT000746	hsa-miR-34c-5p	Review, Microarray	19461653
MIRT000720	hsa-miR-34a-5p	qRT-PCR, Western blot, Luciferase reporter assay	19584398
MIRT000720	hsa-miR-34a-5p	qRT-PCR, Western blot, Luciferase reporter assay	19584398
MIRT000720	hsa-miR-34a-5p	qRT-PCR, Western blot, Luciferase reporter assay	19584398
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, Western blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, Western blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, Western blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, Western blot	18539114
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	18814950
MIRT003539	rno-miR-150-5p	qRT-PCR, Western blot	19892940
MIRT004637	hsa-miR-16-5p	Review	20029422
MIRT000935	hsa-miR-150-5p	Review	20029422
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assay, Western blot	18818396
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assay, Western blot	18818396
MIRT003802	hsa-miR-107	Luciferase reporter assay, Western blot	18818396
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assay, Microarray, qRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assay, Microarray, qRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assay, Microarray, qRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assay, Microarray, qRT-PCR	21205891
MIRT004637	hsa-miR-16-5p	Luciferase reporter assay, Microarray, qRT-PCR	21205891
MIRT005884	hsa-miR-155-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT005884	hsa-miR-155-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT005884	hsa-miR-155-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT005884	hsa-miR-155-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT005886	hsa-miR-424-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT005886	hsa-miR-424-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT005886	hsa-miR-424-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT005886	hsa-miR-424-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	21062812
MIRT000935	hsa-miR-150-5p	qRT-PCR, Western blot	21590770
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay	20603081
MIRT016588	hsa-miR-193b-3p	Microarray	20304954
MIRT005884	hsa-miR-155-5p	Reporter assay	20680360
MIRT000935	hsa-miR-150-5p	Reporter assay	17923094
MIRT000935	hsa-miR-150-5p	Reporter assay;Western blot;Other	18667440
MIRT024449	hsa-miR-215-5p	Microarray	19074876
MIRT000720	hsa-miR-34a-5p	Proteomics	21566225
MIRT026025	hsa-miR-198	qRT-PCR	18667440
MIRT026947	hsa-miR-192-5p	Microarray	19074876
MIRT042569	hsa-miR-423-3p	CLASH	23622248
MIRT052922	hsa-miR-200a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22101269
MIRT052922	hsa-miR-200a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22101269
MIRT052922	hsa-miR-200a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22101269
MIRT052923	hsa-miR-200b-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22101269
MIRT052923	hsa-miR-200b-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22101269
MIRT052923	hsa-miR-200b-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22101269
MIRT000935	hsa-miR-150-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22025269
MIRT052923	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	22101269
MIRT052964	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22101269
MIRT052965	hsa-miR-429	Luciferase reporter assay, Western blot	22101269
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, Microarray, qRT-PCR	23604034
MIRT005886	hsa-miR-424-5p	Luciferase reporter assay, qRT-PCR, Western blot	24675898
MIRT053183	hsa-miR-150-3p	and Hep3B)"	22025269
MIRT053183	hsa-miR-150-3p	and Hep3B)"	22025269
MIRT005884	hsa-miR-155-5p	Microarray	23807165
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25530421
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25530421
MIRT000935	hsa-miR-150-5p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR, Western blot	24613688
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	24438945
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	24438945
MIRT054890	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	24486218
MIRT054890	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	24486218
MIRT000935	hsa-miR-150-5p	Luciferase reporter assay, Microarray	24086639
MIRT000935	hsa-miR-150-5p	Flow, qRT-PCR, Western blot	23521217
MIRT000720	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT438084	hsa-miR-105-5p	Luciferase reporter assay, qRT-PCR, Western blot	24446170
MIRT000720	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT438084	hsa-miR-105-5p	Luciferase reporter assay, qRT-PCR, Western blot	24446170
MIRT016588	hsa-miR-193b-3p	Luciferase reporter assay	25231743
MIRT016588	hsa-miR-193b-3p	Luciferase reporter assay	25231743
MIRT016588	hsa-miR-193b-3p	Luciferase reporter assay	25231743
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337280
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337280
MIRT000283	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337280
MIRT000283	hsa-miR-106a-5p	Luciferase reporter assay	26265888
MIRT000283	hsa-miR-106a-5p	Luciferase reporter assay	26265888
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	27888798
MIRT054262	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	27888798
MIRT006604	hsa-miR-150-5p	qRT-PCR	32490599
MIRT006604	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31570789
MIRT755672	hsa-miR-200c-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37807322
MIRT756197	hsa-miR-187-5p	Luciferase reporter assay, Western blotting	35096852
MIRT1167328	hsa-miR-103a	CLIP-seq
MIRT1167329	hsa-miR-105	CLIP-seq
MIRT1167330	hsa-miR-124	CLIP-seq
MIRT1167331	hsa-miR-1243	CLIP-seq
MIRT1167332	hsa-miR-1245	CLIP-seq
MIRT1167333	hsa-miR-1264	CLIP-seq
MIRT1167334	hsa-miR-1267	CLIP-seq
MIRT1167335	hsa-miR-1273d	CLIP-seq
MIRT1167336	hsa-miR-130a	CLIP-seq
MIRT1167337	hsa-miR-130b	CLIP-seq
MIRT1167338	hsa-miR-134	CLIP-seq
MIRT1167339	hsa-miR-139-5p	CLIP-seq
MIRT1167340	hsa-miR-140-3p	CLIP-seq
MIRT1167341	hsa-miR-148a	CLIP-seq
MIRT1167342	hsa-miR-148b	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167344	hsa-miR-152	CLIP-seq
MIRT1167345	hsa-miR-153	CLIP-seq
MIRT1167346	hsa-miR-155	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167350	hsa-miR-1911	CLIP-seq
MIRT1167351	hsa-miR-1913	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT1167353	hsa-miR-200b	CLIP-seq
MIRT1167354	hsa-miR-200c	CLIP-seq
MIRT1167355	hsa-miR-2116	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167357	hsa-miR-298	CLIP-seq
MIRT1167358	hsa-miR-301a	CLIP-seq
MIRT1167359	hsa-miR-301b	CLIP-seq
MIRT1167360	hsa-miR-3118	CLIP-seq
MIRT1167361	hsa-miR-3140-3p	CLIP-seq
MIRT1167362	hsa-miR-3148	CLIP-seq
MIRT1167363	hsa-miR-3187-3p	CLIP-seq
MIRT1167364	hsa-miR-324-3p	CLIP-seq
MIRT1167365	hsa-miR-34a	CLIP-seq
MIRT1167366	hsa-miR-3591-3p	CLIP-seq
MIRT1167367	hsa-miR-3591-5p	CLIP-seq
MIRT1167368	hsa-miR-3606	CLIP-seq
MIRT1167369	hsa-miR-3609	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167371	hsa-miR-3616-5p	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167373	hsa-miR-3647-5p	CLIP-seq
MIRT1167374	hsa-miR-3654	CLIP-seq
MIRT1167375	hsa-miR-3666	CLIP-seq
MIRT1167376	hsa-miR-3667-5p	CLIP-seq
MIRT1167377	hsa-miR-3691-3p	CLIP-seq
MIRT1167378	hsa-miR-369-5p	CLIP-seq
MIRT1167379	hsa-miR-3714	CLIP-seq
MIRT1167380	hsa-miR-371-5p	CLIP-seq
MIRT1167381	hsa-miR-371b-5p	CLIP-seq
MIRT1167382	hsa-miR-3910	CLIP-seq
MIRT1167383	hsa-miR-3912	CLIP-seq
MIRT1167384	hsa-miR-3923	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT1167386	hsa-miR-4255	CLIP-seq
MIRT1167387	hsa-miR-4275	CLIP-seq
MIRT1167388	hsa-miR-4276	CLIP-seq
MIRT1167389	hsa-miR-4295	CLIP-seq
MIRT1167390	hsa-miR-4438	CLIP-seq
MIRT1167391	hsa-miR-4477a	CLIP-seq
MIRT1167392	hsa-miR-449a	CLIP-seq
MIRT1167393	hsa-miR-449b	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167396	hsa-miR-4529-5p	CLIP-seq
MIRT1167397	hsa-miR-454	CLIP-seq
MIRT1167398	hsa-miR-4635	CLIP-seq
MIRT1167399	hsa-miR-4652-3p	CLIP-seq
MIRT1167400	hsa-miR-4661-5p	CLIP-seq
MIRT1167401	hsa-miR-4662a-3p	CLIP-seq
MIRT1167402	hsa-miR-4671-3p	CLIP-seq
MIRT1167403	hsa-miR-4677-5p	CLIP-seq
MIRT1167404	hsa-miR-4711-5p	CLIP-seq
MIRT1167405	hsa-miR-4713-5p	CLIP-seq
MIRT1167406	hsa-miR-4717-3p	CLIP-seq
MIRT1167407	hsa-miR-4733-5p	CLIP-seq
MIRT1167408	hsa-miR-4749-3p	CLIP-seq
MIRT1167409	hsa-miR-4760-3p	CLIP-seq
MIRT1167410	hsa-miR-4766-5p	CLIP-seq
MIRT1167411	hsa-miR-4782-5p	CLIP-seq
MIRT1167412	hsa-miR-4786-5p	CLIP-seq
MIRT1167413	hsa-miR-4794	CLIP-seq
MIRT1167414	hsa-miR-4795-5p	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167417	hsa-miR-506	CLIP-seq
MIRT1167418	hsa-miR-5095	CLIP-seq
MIRT1167419	hsa-miR-512-3p	CLIP-seq
MIRT1167420	hsa-miR-513a-3p	CLIP-seq
MIRT1167421	hsa-miR-513a-5p	CLIP-seq
MIRT1167422	hsa-miR-519a	CLIP-seq
MIRT1167423	hsa-miR-519b-3p	CLIP-seq
MIRT1167424	hsa-miR-519c-3p	CLIP-seq
MIRT1167425	hsa-miR-532-3p	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167427	hsa-miR-548ac	CLIP-seq
MIRT1167428	hsa-miR-548ah	CLIP-seq
MIRT1167429	hsa-miR-548d-3p	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT1167431	hsa-miR-548t	CLIP-seq
MIRT1167432	hsa-miR-548z	CLIP-seq
MIRT1167433	hsa-miR-568	CLIP-seq
MIRT1167434	hsa-miR-573	CLIP-seq
MIRT1167435	hsa-miR-579	CLIP-seq
MIRT1167436	hsa-miR-592	CLIP-seq
MIRT1167437	hsa-miR-597	CLIP-seq
MIRT1167438	hsa-miR-607	CLIP-seq
MIRT1167439	hsa-miR-643	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167441	hsa-miR-664	CLIP-seq
MIRT1167442	hsa-miR-769-5p	CLIP-seq
MIRT1167443	hsa-miR-891a	CLIP-seq
MIRT1167444	hsa-miR-892b	CLIP-seq
MIRT1167445	hsa-miR-921	CLIP-seq
MIRT1167446	hsa-miR-934	CLIP-seq
MIRT1167329	hsa-miR-105	CLIP-seq
MIRT1167447	hsa-miR-1252	CLIP-seq
MIRT1167448	hsa-miR-1256	CLIP-seq
MIRT1167449	hsa-miR-1271	CLIP-seq
MIRT1167450	hsa-miR-1305	CLIP-seq
MIRT1167340	hsa-miR-140-3p	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167451	hsa-miR-182	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT1167452	hsa-miR-25	CLIP-seq
MIRT1167357	hsa-miR-298	CLIP-seq
MIRT1167362	hsa-miR-3148	CLIP-seq
MIRT1167453	hsa-miR-3163	CLIP-seq
MIRT1167454	hsa-miR-32	CLIP-seq
MIRT1167455	hsa-miR-340	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167456	hsa-miR-363	CLIP-seq
MIRT1167457	hsa-miR-367	CLIP-seq
MIRT1167458	hsa-miR-3671	CLIP-seq
MIRT1167459	hsa-miR-3678-3p	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167460	hsa-miR-4642	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167461	hsa-miR-520d-5p	CLIP-seq
MIRT1167462	hsa-miR-524-5p	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT1167435	hsa-miR-579	CLIP-seq
MIRT1167438	hsa-miR-607	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167463	hsa-miR-92a	CLIP-seq
MIRT1167464	hsa-miR-92b	CLIP-seq
MIRT1167465	hsa-miR-96	CLIP-seq
MIRT1167328	hsa-miR-103a	CLIP-seq
MIRT1167339	hsa-miR-139-5p	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167376	hsa-miR-3667-5p	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT1167390	hsa-miR-4438	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167400	hsa-miR-4661-5p	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167418	hsa-miR-5095	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167446	hsa-miR-934	CLIP-seq
MIRT1167328	hsa-miR-103a	CLIP-seq
MIRT1167329	hsa-miR-105	CLIP-seq
MIRT1167336	hsa-miR-130a	CLIP-seq
MIRT1167337	hsa-miR-130b	CLIP-seq
MIRT1167339	hsa-miR-139-5p	CLIP-seq
MIRT1167340	hsa-miR-140-3p	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167347	hsa-miR-15a	CLIP-seq
MIRT1167348	hsa-miR-15b	CLIP-seq
MIRT1167349	hsa-miR-16	CLIP-seq
MIRT1167352	hsa-miR-195	CLIP-seq
MIRT2048343	hsa-miR-2355-5p	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167358	hsa-miR-301a	CLIP-seq
MIRT1167359	hsa-miR-301b	CLIP-seq
MIRT2048344	hsa-miR-3065-5p	CLIP-seq
MIRT2048345	hsa-miR-3120-5p	CLIP-seq
MIRT1167370	hsa-miR-3613-3p	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167375	hsa-miR-3666	CLIP-seq
MIRT1167376	hsa-miR-3667-5p	CLIP-seq
MIRT1167385	hsa-miR-424	CLIP-seq
MIRT2048346	hsa-miR-4251	CLIP-seq
MIRT2048347	hsa-miR-4277	CLIP-seq
MIRT1167389	hsa-miR-4295	CLIP-seq
MIRT2048348	hsa-miR-4303	CLIP-seq
MIRT2048349	hsa-miR-4329	CLIP-seq
MIRT2048350	hsa-miR-433	CLIP-seq
MIRT1167390	hsa-miR-4438	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT1167395	hsa-miR-4524	CLIP-seq
MIRT1167397	hsa-miR-454	CLIP-seq
MIRT1167399	hsa-miR-4652-3p	CLIP-seq
MIRT2048351	hsa-miR-4659a-3p	CLIP-seq
MIRT2048352	hsa-miR-4659b-3p	CLIP-seq
MIRT1167400	hsa-miR-4661-5p	CLIP-seq
MIRT2048353	hsa-miR-4684-3p	CLIP-seq
MIRT2048354	hsa-miR-4709-5p	CLIP-seq
MIRT1167405	hsa-miR-4713-5p	CLIP-seq
MIRT2048355	hsa-miR-4775	CLIP-seq
MIRT1167412	hsa-miR-4786-5p	CLIP-seq
MIRT1167415	hsa-miR-497	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167418	hsa-miR-5095	CLIP-seq
MIRT2048356	hsa-miR-518a-5p	CLIP-seq
MIRT2048357	hsa-miR-527	CLIP-seq
MIRT1167425	hsa-miR-532-3p	CLIP-seq
MIRT1167426	hsa-miR-545	CLIP-seq
MIRT1167430	hsa-miR-548p	CLIP-seq
MIRT2048358	hsa-miR-590-3p	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167442	hsa-miR-769-5p	CLIP-seq
MIRT1167446	hsa-miR-934	CLIP-seq
MIRT2048359	hsa-miR-942	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167336	hsa-miR-130a	CLIP-seq
MIRT1167337	hsa-miR-130b	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167358	hsa-miR-301a	CLIP-seq
MIRT1167359	hsa-miR-301b	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167375	hsa-miR-3666	CLIP-seq
MIRT1167389	hsa-miR-4295	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT1167397	hsa-miR-454	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167343	hsa-miR-150	CLIP-seq
MIRT1167356	hsa-miR-2682	CLIP-seq
MIRT1167372	hsa-miR-3618	CLIP-seq
MIRT1167394	hsa-miR-449c	CLIP-seq
MIRT2048354	hsa-miR-4709-5p	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT1167416	hsa-miR-503	CLIP-seq
MIRT1167440	hsa-miR-646	CLIP-seq
MIRT2454656	hsa-miR-548c-3p	CLIP-seq
MIRT2576112	hsa-miR-3614-5p	CLIP-seq
MIRT2576113	hsa-miR-3907	CLIP-seq
MIRT2576114	hsa-miR-4272	CLIP-seq
MIRT2576115	hsa-miR-4325	CLIP-seq
MIRT2576112	hsa-miR-3614-5p	CLIP-seq
MIRT2576113	hsa-miR-3907	CLIP-seq
MIRT2576114	hsa-miR-4272	CLIP-seq
MIRT2576115	hsa-miR-4325	CLIP-seq

Transcription factors

Show/Hide all(16)

Transcription factor	Regulation	Reference
BCL3	Unknown	9694711
E2F1	Unknown	8137237
EGR1	Repression	7559553
ETS1	Activation	7848925
FOSL2	Activation	22493372
IRF1	Repression	10739671
JUN	Unknown	1527086
JUND	Activation	22493372
JUND	Repression	18071306
JUND	Unknown	1527086
MYB	Unknown	7655015
TAL1	Activation	22897851
TWIST1	Repression	19051271
TWIST2	Repression	19051271
WT1	Repression	7559553
ZFHX3	Repression	15750593

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20531406
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	7987850, 25857263
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10233885, 25857263
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	18093978, 18548008, 20195357, 20484083, 20802522, 25394790, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20829347
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	2189102
GO:0006816	Process	Calcium ion transport	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014856	Process	Skeletal muscle cell proliferation	IEA
GO:0016363	Component	Nuclear matrix	NAS	3014652
GO:0017145	Process	Stem cell division	IEA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IMP	25857263
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IMP	20484083
GO:0045653	Process	Negative regulation of megakaryocyte differentiation	IMP	25857263
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20531406
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20531406
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	2189102
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	EXP	11792321
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10233885, 20484083, 25857263
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20484083, 20531406
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048566	Process	Embryonic digestive tract development	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0061515	Process	Myeloid cell development	NAS	7684005
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071636	Process	Positive regulation of transforming growth factor beta production	IEA
GO:0071987	Function	WD40-repeat domain binding	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	11792321
GO:1901533	Process	Negative regulation of hematopoietic progenitor cell differentiation	IMP	28111278
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	25857263
GO:1904899	Process	Positive regulation of hepatic stellate cell proliferation	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000491	Process	Positive regulation of hepatic stellate cell activation	IEA
GO:2000845	Process	Positive regulation of testosterone secretion	IEA

MIM	HGNC	e!Ensembl
189990	7545	ENSG00000118513

Protein

UniProt ID

P10242

Protein name

Transcriptional activator Myb (Proto-oncogene c-Myb)

Protein function

Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00249	Myb_DNA-binding	92 → 138	Myb-like DNA-binding domain	Domain
PF00249	Myb_DNA-binding	144 → 189	Myb-like DNA-binding domain	Domain
PF07988	LMSTEN	267 → 313	LMSTEN motif	Motif
PF09316	Cmyb_C	399 → 563	C-myb, C-terminal	Family

Sequence

MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT
STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIK
YGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF
FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP
LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM

Sequence length

640

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway		RUNX1 regulates transcription of genes involved in differentiation of HSCs Estrogen-dependent gene expression

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (122)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	28102292
Adenoma	Associate	24472434
Adenoma Pleomorphic	Associate	24302647
Adenomatous Polyposis Coli	Associate	24472434
Aicardi Syndrome	Associate	20702610, 24302647, 24893972, 26631609, 28085142, 28719465, 29978608, 31857685, 34011559
Aicardi Syndrome	Stimulate	21785271
Anemia Hemolytic	Associate	29879141
Anemia Sickle Cell	Associate	18667698, 21068433, 21205891, 24614105, 24667352, 25084696, 25928412, 28332727, 29879141, 38339995
Asthma	Associate	23606399
Astrocytoma	Stimulate	21046410
Astrocytoma	Associate	23881924, 26810070, 31563982, 36074655, 37165121
Ataxia Telangiectasia	Associate	17452517
Atrial Fibrillation	Associate	34938350
beta Thalassemia	Associate	19696200, 21068433, 21205891, 21385855, 22271886, 24614105, 25928412, 27009595, 28280727, 34795208
Bone Neoplasms	Associate	23199169
Brain Neoplasms	Associate	36074655
Breast Neoplasms	Associate	17690249, 19036881, 19841262, 20043041, 20237898, 20547751, 20949095, 21261996, 21482760, 22492511, 23098454, 23935942, 24067373, 24283570, 24297604 View all (11 more)
Burkitt Lymphoma	Inhibit	23237561
Burkitt Lymphoma	Associate	23521217, 29415639, 35205272
Calcinosis Cutis	Associate	36576236
Carcinogenesis	Associate	20949095, 22492511, 24675898, 31483290, 34719326
Carcinoma Adenoid Cystic	Associate	19841262, 20702610, 20978318, 21164292, 21324728, 21572406, 21785271, 21976542, 23398044, 23778135, 23778141, 24302647, 24576033, 24732452, 25951887 View all (38 more)
Carcinoma Basal Cell	Associate	31189999
Carcinoma Hepatocellular	Associate	21190594, 24675898
Carcinoma Non Small Cell Lung	Associate	1690210
Chromosome Aberrations	Associate	2829178
Colonic Neoplasms	Stimulate	15001837
Colonic Neoplasms	Associate	17690249
Colorectal Neoplasms	Associate	11290547, 15001837, 20237898, 26873484, 26934556
Colorectal Neoplasms	Inhibit	34286904
Congenital Abnormalities	Associate	26969893
COVID 19	Associate	36758547, 37762093
Death	Associate	32650834, 33668731
Diffuse Intrinsic Pontine Glioma	Associate	37165121
Disease	Associate	33990643
Drug Related Side Effects and Adverse Reactions	Inhibit	15001837
Ectodermal Dysplasia	Associate	28085142, 31483290
Endocrine Gland Neoplasms	Associate	24979764
Endometriosis	Associate	32802844
Eosinophilia	Associate	23606399, 38010473
Fibrocystic Breast Disease	Associate	27491809, 29149504, 35590093
Fibrocystic Breast Disease	Stimulate	37660928
Ganglioglioma	Associate	24767714
Glioblastoma	Associate	7688794
Glioma	Associate	21046410, 26810070, 28575485, 31038238, 31563982, 36074655, 36776924, 37165121, 40702569
Head and Neck Neoplasms	Associate	25963073, 39218775
Hereditary Breast and Ovarian Cancer Syndrome	Associate	25951887, 29149504
Hodgkin Disease	Associate	35205272
Hyperglycemia	Associate	26934556
Hyperkeratosis Epidermolytic	Associate	37929023
Hypomagnesemia primary	Associate	33668731
Inflammation	Associate	31928012, 37762093
Inflammation	Inhibit	33621853
Intracranial Arteriovenous Malformations	Associate	23483952
Isodicentric Chromosome 15 Syndrome	Associate	33980539
Leukemia	Associate	10671493, 1451597, 1495997, 16421272, 18056083, 18195038, 19841262, 2006173, 20237898, 21261996, 21795403, 21853052, 22051105, 2506946, 2541445 View all (12 more)
Leukemia	Stimulate	20925909
Leukemia Biphenotypic Acute	Associate	20484083, 29135517
Leukemia Lymphocytic Chronic B Cell	Associate	21296997
Leukemia Lymphoma Adult T Cell	Associate	31628193
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	11830460, 1562723, 18550858, 2006173
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	8195713
Leukemia Myeloid	Associate	15187020, 2541445, 33637692, 38462943
Leukemia Myeloid Acute	Associate	10590070, 1371419, 2006173, 21364958, 22110127, 25924238, 29316424, 30177851, 31164492, 33527899, 33958723, 35368048, 35406726, 35709529, 35743167, 36913305, 38462943 View all (2 more)
Leukemia Myeloid Acute	Stimulate	15187020
Leukemia Myelomonocytic Chronic	Associate	21828134
Leukemia Promyelocytic Acute	Associate	35653587
Leukemia T Cell	Associate	17452517, 37996430, 40378042, 8123474
Light Fixation Seizure Syndrome	Associate	31483290
Liver Cirrhosis Biliary	Associate	31948396
Lung Neoplasms	Associate	22253833, 28754957
Lupus Erythematosus Systemic	Inhibit	3701256
Lymphoma	Associate	18195038, 32526676
Lymphoma Extranodal NK T Cell	Associate	23963825
Lymphoma Large B Cell Diffuse	Associate	35205272
Lymphoma Non Hodgkin	Stimulate	21046410
Lymphoma Non Hodgkin	Associate	36074655
Lymphoma Primary Effusion	Associate	17659053
Lymphoma T Cell Cutaneous	Associate	11675351
Malaria	Associate	25069958
Medulloblastoma	Associate	16783165
Melanoma	Associate	23800576, 2829178
Myelodysplastic Syndromes	Associate	35136029
Nasopharyngeal Carcinoma	Associate	22260379
Neoplasm Metastasis	Associate	21190594, 32650834, 33621853, 33668731, 38493544
Neoplasm Metastasis	Inhibit	26873484
Neoplasms	Associate	10677346, 11290547, 15001837, 18708755, 19091943, 19841262, 20702610, 20949095, 21164292, 21261996, 21853052, 2188096, 22051105, 22579713, 23117580 View all (43 more)
Neoplasms	Stimulate	21572406, 25616133
Neoplasms Cystic Mucinous and Serous	Stimulate	34145334
Neoplasms Glandular and Epithelial	Associate	38010473
Neoplasms Neuroepithelial	Associate	26810070
Neuroblastoma	Associate	2123747, 30483774, 3380093
Niemann Pick Disease Type C	Associate	25616133
Osteosarcoma	Associate	26768615, 35461324
Ovarian Diseases	Associate	21237494
Ovarian Neoplasms	Associate	32878513, 34145334
Pain	Associate	18667698, 34283174
Pancreatic Neoplasms	Associate	23675407, 27354262, 31928012
Personality Disorders	Associate	21164292
Polycythemia Vera	Associate	19264517
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	21853052
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	11552989, 2432398, 28671688
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16029452, 16644881, 17452517, 18070937, 25394790, 26004809, 30646895, 36424487, 36650499, 37996430
Primary Myelofibrosis	Associate	17976522, 25252869
Prostatic Neoplasms	Associate	22431717, 36321189, 36410437
Prostatitis	Stimulate	36321189
Ring Chromosome 20 Syndrome	Associate	31483290
Salivary Duct Calculi	Associate	32929114
Salivary Gland Neoplasms	Associate	34176176
Sezary Syndrome	Associate	23698072, 28489605
Sinonasal undifferentiated carcinoma	Associate	30027386
Skin Diseases	Associate	11675351
Spinocerebellar Ataxia 11	Associate	24667352
Stomach Neoplasms	Associate	21931799, 25530421, 28078605, 32309437, 37752199, 37781029
Thalassemia	Associate	33990643
Thrombocythemia Essential	Associate	25849990, 29047144
Thyroid Cancer Papillary	Associate	38497387
Triple Negative Breast Neoplasms	Associate	27491809, 28697743
Trisomy 13 Syndrome	Associate	21205891
Tuberculosis Multidrug Resistant	Associate	33515271
Urinary Bladder Neoplasms	Associate	36994664
Uterine Cervical Neoplasms	Associate	36028854

MYB (MYB proto-oncogene, transcription factor)