Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4598
Gene name Gene Name - the full gene name approved by the HGNC.
Mevalonate kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MVK
Synonyms (NCBI Gene) Gene synonyms aliases
LRBP, MK, MVLK, POROK3
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28934897 G>A Pathogenic, uncertain-significance Missense variant, genic downstream transcript variant, coding sequence variant
rs72648042 C>T Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, synonymous variant, coding sequence variant
rs76914224 G>A Conflicting-interpretations-of-pathogenicity, likely-benign, not-provided Coding sequence variant, missense variant
rs104895298 G>A Pathogenic, not-provided Coding sequence variant, intron variant, missense variant
rs104895300 C>T Pathogenic, likely-pathogenic Coding sequence variant, intron variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022207 hsa-miR-124-3p Microarray 18668037
MIRT724892 hsa-miR-4519 HITS-CLIP 19536157
MIRT724891 hsa-miR-4530 HITS-CLIP 19536157
MIRT724890 hsa-miR-338-3p HITS-CLIP 19536157
MIRT724889 hsa-miR-766-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000287 Function Magnesium ion binding ISS
GO:0004496 Function Mevalonate kinase activity IBA
GO:0004496 Function Mevalonate kinase activity IDA 1377680, 9325256, 14680974, 14730012, 18302342
GO:0004496 Function Mevalonate kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
251170 7530 ENSG00000110921
Protein
UniProt ID Q03426
Protein name Mevalonate kinase (MK) (EC 2.7.1.36)
Protein function Catalyzes the phosphorylation of mevalonate to mevalonate 5-phosphate, a key step in isoprenoid and cholesterol biosynthesis (PubMed:11278915, PubMed:18302342, PubMed:9325256, PubMed:9392419). {ECO:0000269|PubMed:11278915, ECO:0000269|PubMed:183
PDB 2R3V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00288 GHMP_kinases_N 130 212 GHMP kinases N terminal domain Family
PF08544 GHMP_kinases_C 289 366 GHMP kinases C terminal Family
Sequence
MLSEVLLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKR
AWDVARLQSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSIC
RKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTVCEEIPNPLKDGDCVNRWTKE
DLELINKWAFQGERMIHGNPSGVDNAVSTWGG
ALRYHQGKISSLKRSPALQILLTNTKVP
RNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLEELIDM
NQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQAL
TSCGFD
CLETSIGAPGVSIHSATSLDSRVQQALDGL
Sequence length 396
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
  Cholesterol biosynthesis
Activation of gene expression by SREBF (SREBP)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Autoinflammatory Disease Autoinflammatory syndrome rs104895352, rs104895364, rs104895319, rs104895311 N/A
Hyperimmunoglobulinemia Hyperimmunoglobulin D with periodic fever rs104895321, rs104895373, rs104895370, rs104895332, rs104895304, rs104895352, rs104895382, rs104895335, rs121917790, rs104895307, rs104895364, rs104895319, rs104895305, rs104895297, rs104895322
View all (25 more)
N/A
Porokeratosis Porokeratosis 3, disseminated superficial actinic type rs397514571, rs398122910, rs398122911, rs104895362, rs397514570, rs104895301, rs104895373 N/A
retinal dystrophy Retinal dystrophy rs104895298, rs104895317, rs104895316 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Disseminated Superficial Actinic Porokeratosis disseminated superficial actinic porokeratosis N/A N/A GenCC
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Pain Associate 35387795
Acute Febrile Encephalopathy Associate 24073415
Adenocarcinoma of Lung Stimulate 39844257
Behcet Syndrome Associate 17213252, 28814775, 30808881
Carcinoma Hepatocellular Associate 7747441
Cerebral Infarction Associate 30101835
Coronary Disease Associate 27716295, 30101835
Cryopyrin Associated Periodic Syndromes Associate 19877056
Depressive Disorder Major Associate 34171401
Developmental Disabilities Associate 40717084