Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4595
Gene name Gene Name - the full gene name approved by the HGNC.
MutY DNA glycosylase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MUTYH
Synonyms (NCBI Gene) Gene synonyms aliases
MYH
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a DNA glycosylase involved in oxidative DNA damage repair. The enzyme excises adenine bases from the DNA backbone at sites where adenine is inappropriately paired with guanine, cytosine, or 8-oxo-7,8-dihydroguanine, a major oxidatively d
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs3219488 G>A Likely-benign, conflicting-interpretations-of-pathogenicity Intron variant
rs34126013 G>A Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
rs34612342 T>C Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs35352891 G>A Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, missense variant, non coding transcript variant
rs36053993 C>A,T Pathogenic, uncertain-significance, pathogenic-likely-pathogenic, likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT640343 hsa-miR-4637 HITS-CLIP 23824327
MIRT640342 hsa-miR-3664-3p HITS-CLIP 23824327
MIRT640341 hsa-miR-1266-5p HITS-CLIP 23824327
MIRT640340 hsa-miR-4518 HITS-CLIP 23824327
MIRT640339 hsa-miR-4320 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000701 Function Purine-specific mismatch base pair DNA N-glycosylase activity IBA
GO:0000701 Function Purine-specific mismatch base pair DNA N-glycosylase activity IEA
GO:0000701 Function Purine-specific mismatch base pair DNA N-glycosylase activity IMP 20848659
GO:0003677 Function DNA binding IEA
GO:0003824 Function Catalytic activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604933 7527 ENSG00000132781
Protein
UniProt ID Q9UIF7
Protein name Adenine DNA glycosylase (EC 3.2.2.31) (MutY homolog) (hMYH)
Protein function Involved in oxidative DNA damage repair. Initiates repair of A*oxoG to C*G by removing the inappropriately paired adenine base from the DNA backbone. Possesses both adenine and 2-OH-A DNA glycosylase activities. {ECO:0000269|PubMed:10684930, ECO
PDB 1X51 , 3N5N , 8FAY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00730 HhH-GPD 129 265 HhH-GPD superfamily base excision DNA repair protein Domain
PF00633 HHH 193 223 Helix-hairpin-helix motif Motif
PF14815 NUDIX_4 370 493 NUDIX domain Domain
Sequence
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGMIAECPG
APAGLARQPEEVVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDL
DRRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRG
RRLQEGARKVVE
ELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVL
CRVRAIGADPSSTLVSQQLWGLAQQ
LVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVE
SLCRARQRVEQEQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKAS
RKPPREESSATCVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQE
LQRWAGPLPATHLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHT
AAVSTAMKKVFRV
YQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHS
LNSAAQ
Sequence length 546
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Base excision repair   Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Displacement of DNA glycosylase by APEX1
Defective MUTYH substrate binding
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Adenomatous Polyposis Familial adenomatous polyposis 2 rs587778536, rs767402084, rs886046367, rs745910470, rs587781628, rs1553125100, rs1060501321, rs1064793197, rs748170941, rs762307622, rs1437789978, rs1553125622, rs1553136984, rs1057517459, rs34126013
View all (119 more)
N/A
Breast Carcinoma breast carcinoma rs587778541, rs374950566, rs140342925, rs587783057 N/A
gastric cancer Gastric cancer rs786203115, rs121908383, rs762307622, rs730881833, rs1570406302, rs200495564, rs34612342, rs769237459, rs587782885, rs587783057, rs587780088, rs765123255 N/A
colon cancer Colon cancer rs587781864, rs587780751 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Malignant tumor of breast N/A N/A ClinVar
hereditary cancer Hereditary cancer N/A N/A ClinVar
Lynch syndrome Lynch syndrome 1 N/A N/A ClinVar
Multiple polyposis syndrome Familial multiple polyposis syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 19161591, 24377542, 34173730
Adenocarcinoma Follicular Associate 34171097
Adenocarcinoma Of Esophagus Associate 24377542
Adenocarcinoma of Lung Associate 29209987
Adenoma Associate 12606733, 12707038, 12937124, 14691304, 16521226, 16645203, 16943222, 18564191, 19531215, 20687945, 22851115, 23561487, 23599153, 29766397, 31104418
View all (3 more)
Adenomatous Polyposis Coli Associate 12606733, 16140997, 16521226, 16943222, 17122612, 17273161, 17605803, 18022921, 18091433, 18194984, 18503156, 18564191, 19531215, 19836313, 20687945
View all (32 more)
Adenomatous Polyps Associate 15931596, 29766397
Arthritis Rheumatoid Associate 26273655, 28173856
Attenuated familial adenomatous polyposis Associate 18091433, 19531215, 22851115, 31285513
Breast Neoplasms Associate 21952991, 22126480, 22297469, 25503501, 26824983, 27194394, 27630279, 30833417, 31575519, 31780696, 31811167, 32868316, 33827469, 33942220, 34866136
View all (5 more)