MUC7 (mucin 7, secreted)

Gene

• Entrez ID: 4589
• Gene name: Mucin 7, secreted
• Gene symbol: MUC7
• Synonyms (NCBI Gene): MG2
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029062	hsa-miR-26b-5p	Microarray	19088304
MIRT1166411	hsa-miR-1206	CLIP-seq
MIRT1166412	hsa-miR-185	CLIP-seq
MIRT1166413	hsa-miR-375	CLIP-seq
MIRT1166414	hsa-miR-4306	CLIP-seq
MIRT1166415	hsa-miR-4644	CLIP-seq
MIRT1166416	hsa-miR-4760-5p	CLIP-seq
MIRT1166417	hsa-miR-511	CLIP-seq
MIRT1166418	hsa-miR-516b	CLIP-seq
MIRT1166419	hsa-miR-576-3p	CLIP-seq
MIRT2575574	hsa-miR-505	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16203048
GO:0005576	Component	Extracellular region	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0031640	Process	Killing of cells of another organism	IDA	12543672
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12543672
GO:0070062	Component	Extracellular exosome	HDA	19199708

Other IDs

• MIM: 158375
• HGNC: 7518
• e!Ensembl: ENSG00000171195

Protein

• UniProt ID: Q8TAX7
• Protein name: Mucin-7 (MUC-7) (Apo-MG2) (Salivary mucin-7)
• Protein function: May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili.
• Tissue specificity: TISSUE SPECIFICITY: Expressed in salivary gland tissues and only in those that contain mucous acinar cells (e.g. sublingual and submandibular glands) and not in salivary glands containing only serous acinar cells (e.g. parotid gland). {ECO:0000269|PubMed:
• Sequence:

  MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIR
  KSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSAS
  TKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPP
  SSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPT
  PSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAP
  QETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFL
  LYMKNLLNRIIDDMVEQ

• Sequence length: 377

Pathways

KEGG:

Salivary secretion

Reactome:

Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, protection against	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Aggressive Periodontitis	Associate	22167029	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	23457413	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	19820409, 36344553	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Associate	27683054	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	39306032	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	25573589	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Associate	28742274	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	23457413	★☆☆☆☆ Found in Text Mining only
Microsatellite Instability	Associate	25573589	★☆☆☆☆ Found in Text Mining only
Necrosis	Associate	27683054	★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Stimulate	14678183	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	18717013, 25573589, 27683054	★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	22167029	★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Stimulate	38133771	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	33315534, 33530209	★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Inhibit	19820409	★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	36344553	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	25573589	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	14678183	★☆☆☆☆ Found in Text Mining only