MUC7 (mucin 7, secreted)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4589
Gene name Gene Name - the full gene name approved by the HGNC.
Mucin 7, secreted
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MUC7
Synonyms (NCBI Gene) Gene synonyms aliases
MG2
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT029062 hsa-miR-26b-5p Microarray 19088304
MIRT1166411 hsa-miR-1206 CLIP-seq
MIRT1166412 hsa-miR-185 CLIP-seq
MIRT1166413 hsa-miR-375 CLIP-seq
MIRT1166414 hsa-miR-4306 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway TAS
GO:0005515 Function Protein binding IPI 16203048
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane TAS
GO:0016266 Process O-glycan processing TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
158375 7518 ENSG00000171195
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8TAX7
Protein name Mucin-7 (MUC-7) (Apo-MG2) (Salivary mucin-7)
Protein function May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in salivary gland tissues and only in those that contain mucous acinar cells (e.g. sublingual and submandibular glands) and not in salivary glands containing only serous acinar cells (e.g. parotid gland). {ECO:0000269|PubMed:
Sequence 
MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIR
KSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSAS
TKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPP
SSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPT
PSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAP
QETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFL
LYMKNLLNRIIDDMVEQ
Sequence length 377
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Salivary secretion   Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma ClinVar
Uterine Fibroids Uterine Fibroids GWAS
Sarcoidosis Sarcoidosis GWAS
Show/Hide Text Mining Associations (19)
Associations from Text Mining
Disease Name Relationship Type References
Aggressive Periodontitis Associate 22167029
Arthritis Rheumatoid Associate 23457413
Asthma Associate 19820409, 36344553
Carcinoma Renal Cell Associate 27683054
Cardiovascular Diseases Associate 39306032
Colorectal Neoplasms Associate 25573589
Hemangioblastoma Associate 28742274
Inflammation Associate 23457413
Microsatellite Instability Associate 25573589
Necrosis Associate 27683054