Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4541
Gene name Gene Name - the full gene name approved by the HGNC.	Mitochondrially encoded NADH dehydrogenase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ND6
Synonyms (NCBI Gene) Gene synonyms aliases	MTND6
Chromosome Chromosome number	MT
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	-

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048059	hsa-miR-197-3p	CLASH	23622248
MIRT047901	hsa-miR-30c-5p	CLASH	23622248
MIRT047901	hsa-miR-30c-5p	CLASH	23622248
MIRT047440	hsa-miR-10b-5p	CLASH	23622248
MIRT046027	hsa-miR-125b-5p	CLASH	23622248
MIRT045743	hsa-miR-125a-5p	CLASH	23622248
MIRT045537	hsa-miR-149-5p	CLASH	23622248
MIRT045537	hsa-miR-149-5p	CLASH	23622248
MIRT044193	hsa-miR-99b-5p	CLASH	23622248
MIRT043775	hsa-miR-328-3p	CLASH	23622248
MIRT041704	hsa-miR-484	CLASH	23622248
MIRT041704	hsa-miR-484	CLASH	23622248
MIRT038330	hsa-miR-130b-5p	CLASH	23622248
MIRT036990	hsa-miR-877-3p	CLASH	23622248

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IMP	8644732, 14595656
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IEA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IMP	8644732, 14595656
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	14595656
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
516006	7462	HGNC

Protein

UniProt ID

P03923

Protein name

NADH-ubiquinone oxidoreductase chain 6 (EC 7.1.1.2) (NADH dehydrogenase subunit 6)

Protein function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor (PubMed:14595656, PubMed:8644732). Es

PDB

5XTC , 5XTD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00499	Oxidored_q3	15 → 170	NADH-ubiquinone/plastoquinone oxidoreductase chain 6	Family

Sequence

MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYL
GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNS
VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

Sequence length

174

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

ND6 (mitochondrially encoded NADH dehydrogenase 6)