Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4540
Gene name	Mitochondrially encoded NADH dehydrogenase 5
Gene symbol	ND5
Synonyms (NCBI Gene)	MTND5
Chromosome	MT
Chromosome location	-

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052454	hsa-let-7a-5p	CLASH	23622248
MIRT052454	hsa-let-7a-5p	CLASH	23622248
MIRT052013	hsa-let-7b-5p	CLASH	23622248
MIRT052013	hsa-let-7b-5p	CLASH	23622248
MIRT052013	hsa-let-7b-5p	CLASH	23622248
MIRT052013	hsa-let-7b-5p	CLASH	23622248
MIRT052013	hsa-let-7b-5p	CLASH	23622248
MIRT052013	hsa-let-7b-5p	CLASH	23622248
MIRT051769	hsa-let-7c-5p	CLASH	23622248
MIRT051769	hsa-let-7c-5p	CLASH	23622248
MIRT051769	hsa-let-7c-5p	CLASH	23622248
MIRT051464	hsa-let-7e-5p	CLASH	23622248
MIRT051464	hsa-let-7e-5p	CLASH	23622248
MIRT051359	hsa-let-7f-5p	CLASH	23622248
MIRT048240	hsa-miR-196a-5p	CLASH	23622248
MIRT045017	hsa-miR-186-5p	CLASH	23622248
MIRT044636	hsa-miR-320a	CLASH	23622248
MIRT042684	hsa-miR-196b-5p	CLASH	23622248
MIRT038463	hsa-miR-296-3p	CLASH	23622248
MIRT038034	hsa-miR-423-5p	CLASH	23622248
MIRT035951	hsa-miR-1180-3p	CLASH	23622248
MIRT737117	hsa-miR-574-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)ImmunofluorescenceqRT-PCRFlow cytometry	32381753

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IMP	15250827
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	3921850
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IEA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IEA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IMP	15250827
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	3921850
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0015990	Process	Electron transport coupled proton transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	15250827
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042773	Process	ATP synthesis coupled electron transport	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	3921850

MIM	HGNC	e!Ensembl
516005	7461	HGNC

P03915

Protein name

NADH-ubiquinone oxidoreductase chain 5 (EC 7.1.1.2) (NADH dehydrogenase subunit 5)

Protein function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor (PubMed:15250827). Essential for the

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00662	Proton_antipo_N	65 → 122	NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus	Family
PF00361	Proton_antipo_M	134 → 419	Proton-conducting membrane transporter	Family
PF06455	NADH5_C	422 → 602	NADH dehydrogenase subunit 5 C-terminus	Family

Sequence

MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTFIISLFPTTMFMCLDQE
VIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKY
LLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRIGDI
GFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPWLPSAMEGP
TPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVCALTQNDIKK
IVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMG
GLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHIIETANMSYTNAWALSITLIATSLTS
AYSTRMILLTLTGQPRFPTLTNINENNPTLLNPIKRLAAGSLFAGFLITNNISPASPFQT
TIPLYLKLTALAVTFLGLLTALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSITHRTIPYL
GLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLL
LIT

Sequence length

603

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

ND5 (mitochondrially encoded NADH dehydrogenase 5)