Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4538
Gene name	Mitochondrially encoded NADH dehydrogenase 4
Gene symbol	ND4
Synonyms (NCBI Gene)	MTND4
Chromosome	MT
Chromosome location	-

Show/Hide all (20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051935	hsa-let-7b-5p	CLASH	23622248
MIRT051935	hsa-let-7b-5p	CLASH	23622248
MIRT051935	hsa-let-7b-5p	CLASH	23622248
MIRT051789	hsa-let-7c-5p	CLASH	23622248
MIRT051479	hsa-let-7e-5p	CLASH	23622248
MIRT051369	hsa-let-7f-5p	CLASH	23622248
MIRT051369	hsa-let-7f-5p	CLASH	23622248
MIRT050806	hsa-miR-17-5p	CLASH	23622248
MIRT050806	hsa-miR-17-5p	CLASH	23622248
MIRT048266	hsa-miR-196a-5p	CLASH	23622248
MIRT044452	hsa-miR-320a	CLASH	23622248
MIRT044452	hsa-miR-320a	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT039502	hsa-miR-652-3p	CLASH	23622248
MIRT038401	hsa-miR-296-3p	CLASH	23622248
MIRT038401	hsa-miR-296-3p	CLASH	23622248
MIRT037806	hsa-miR-455-3p	CLASH	23622248
MIRT048266	hsa-miR-196a-5p	RNA-seqqRT-PCR	33090325

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0003954	Function	NADH dehydrogenase activity	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IMP	8344246, 8644732, 15250827
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	3921850
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IEA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IMP	8344246, 8644732, 15250827
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	3921850
GO:0009060	Process	Aerobic respiration	IBA
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0015990	Process	Electron transport coupled proton transport	IBA
GO:0016020	Component	Membrane	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	8344246, 15250827
GO:0035094	Process	Response to nicotine	IEA
GO:0042773	Process	ATP synthesis coupled electron transport	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	3921850
GO:0045471	Process	Response to ethanol	IEA
GO:0048039	Function	Ubiquinone binding	IBA

MIM	HGNC	e!Ensembl
516003	7459	HGNC

P03905

Protein name

NADH-ubiquinone oxidoreductase chain 4 (EC 7.1.1.2) (NADH dehydrogenase subunit 4)

Protein function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor (PubMed:15250827, PubMed:8344246, Pub

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01059	Oxidored_q5_N	1 → 109	NADH-ubiquinone oxidoreductase chain 4, amino terminus	Family
PF00361	Proton_antipo_M	112 → 403	Proton-conducting membrane transporter	Family

Sequence

MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDP
LTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYI
FFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLT
LTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGG
YGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWL
LASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLT
HHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS

Sequence length

459

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

ND4 (mitochondrially encoded NADH dehydrogenase 4)