Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4536
Gene name Gene Name - the full gene name approved by the HGNC.	Mitochondrially encoded NADH dehydrogenase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ND2
Synonyms (NCBI Gene) Gene synonyms aliases	MTND2
Chromosome Chromosome number	MT
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	-

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052497	hsa-let-7a-5p	CLASH	23622248
MIRT051888	hsa-let-7b-5p	CLASH	23622248
MIRT051888	hsa-let-7b-5p	CLASH	23622248
MIRT051888	hsa-let-7b-5p	CLASH	23622248
MIRT051888	hsa-let-7b-5p	CLASH	23622248
MIRT051888	hsa-let-7b-5p	CLASH	23622248
MIRT051888	hsa-let-7b-5p	CLASH	23622248
MIRT051736	hsa-let-7c-5p	CLASH	23622248
MIRT051736	hsa-let-7c-5p	CLASH	23622248
MIRT051443	hsa-let-7e-5p	CLASH	23622248
MIRT051443	hsa-let-7e-5p	CLASH	23622248
MIRT051443	hsa-let-7e-5p	CLASH	23622248
MIRT051443	hsa-let-7e-5p	CLASH	23622248
MIRT050838	hsa-miR-17-5p	CLASH	23622248
MIRT047320	hsa-miR-181a-5p	CLASH	23622248
MIRT043575	hsa-miR-148b-3p	CLASH	23622248
MIRT038380	hsa-miR-296-3p	CLASH	23622248
MIRT038220	hsa-miR-342-5p	CLASH	23622248
MIRT037347	hsa-miR-877-5p	CLASH	23622248
MIRT036721	hsa-miR-760	CLASH	23622248
MIRT036193	hsa-miR-320b	CLASH	23622248

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0005515	Function	Protein binding	IPI	32320651, 33753518
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IBA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IMP	16996290
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	3921850, 9475751
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IBA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IEA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IMP	16996290
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	3921850, 9475751
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	16996290
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	3921850, 9475751
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
516001	7456	HGNC

Protein

UniProt ID

P03891

Protein name

NADH-ubiquinone oxidoreductase chain 2 (EC 7.1.1.2) (NADH dehydrogenase subunit 2)

Protein function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor (PubMed:16996290). Essential for the

PDB

5XTC , 5XTD , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00361	Proton_antipo_M	23 → 288	Proton-conducting membrane transporter	Family
PF06444	NADH_dehy_S2_C	290 → 344	NADH dehydrogenase subunit 2 C-terminus	Family

Sequence

MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYF
LTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQ
GTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILA
YSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWL
TPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYST
SITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL

Sequence length

347

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

ND2 (mitochondrially encoded NADH dehydrogenase 2)