Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4535
Gene name	Mitochondrially encoded NADH dehydrogenase 1
Gene symbol	ND1
Synonyms (NCBI Gene)	MTND1
Chromosome	MT
Chromosome location	-

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052492	hsa-let-7a-5p	CLASH	23622248
MIRT052003	hsa-let-7b-5p	CLASH	23622248
MIRT052003	hsa-let-7b-5p	CLASH	23622248
MIRT052003	hsa-let-7b-5p	CLASH	23622248
MIRT051843	hsa-let-7c-5p	CLASH	23622248
MIRT051843	hsa-let-7c-5p	CLASH	23622248
MIRT051649	hsa-let-7e-5p	CLASH	23622248
MIRT051649	hsa-let-7e-5p	CLASH	23622248
MIRT044550	hsa-miR-320a	CLASH	23622248
MIRT044550	hsa-miR-320a	CLASH	23622248
MIRT039483	hsa-miR-652-3p	CLASH	23622248
MIRT037803	hsa-miR-455-3p	CLASH	23622248
MIRT037400	hsa-miR-744-5p	CLASH	23622248
MIRT037256	hsa-miR-877-5p	CLASH	23622248
MIRT037256	hsa-miR-877-5p	CLASH	23622248
MIRT036713	hsa-miR-760	CLASH	23622248
MIRT036216	hsa-miR-320b	CLASH	23622248
MIRT036162	hsa-miR-320c	CLASH	23622248
MIRT438458	hsa-miR-1-3p	ImmunoprecipitaionLuciferase reporter assay	25083871
MIRT438458	hsa-miR-1-3p	ImmunoprecipitaionLuciferase reporter assay	25083871
MIRT438458	hsa-miR-1-3p	ImmunoprecipitaionLuciferase reporter assay	25083871
MIRT438458	hsa-miR-1-3p	ImmunoprecipitaionLuciferase reporter assay	25083871

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0003954	Function	NADH dehydrogenase activity	IBA
GO:0005515	Function	Protein binding	IPI	12762840, 18486613, 19822128
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IMP	1959619
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	NAS	3921850
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IEA
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	IMP	1959619
GO:0008137	Function	NADH dehydrogenase (ubiquinone) activity	NAS	3921850
GO:0009060	Process	Aerobic respiration	IBA
GO:0009060	Process	Aerobic respiration	NAS	30030361
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	17209039
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	26929434
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0043025	Component	Neuronal cell body	IEA
GO:0045271	Component	Respiratory chain complex I	IBA
GO:0045271	Component	Respiratory chain complex I	IDA	12611891, 17209039
GO:0045271	Component	Respiratory chain complex I	IEA
GO:0045271	Component	Respiratory chain complex I	NAS	3921850
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
516000	7455	HGNC

P03886

Protein name

NADH-ubiquinone oxidoreductase chain 1 (EC 7.1.1.2) (NADH dehydrogenase subunit 1)

Protein function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor (PubMed:1959619). Essential for the c

PDB

5XTC , 5XTD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00146	NADHdh	4 → 305	NADH dehydrogenase	Family

Sequence

MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEP
LKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSG
WASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWP
LAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTT
IFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL
LMWYVSMPITISSIPPQT

Sequence length

318

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport Complex I biogenesis

ND1 (mitochondrially encoded NADH dehydrogenase 1)