Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4524
Gene name Gene Name - the full gene name approved by the HGNC.	Methylenetetrahydrofolate reductase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MTHFR
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.22
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine. Genetic variation in this gene influences susceptibility to occlusive vas

Show/Hide all(81)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1801131	T>G	Benign, benign-likely-benign, other, risk-factor, uncertain-significance	Non coding transcript variant, coding sequence variant, missense variant
rs1801133	G>A,C	Likely-benign, not-provided, conflicting-interpretations-of-pathogenicity, drug-response, other, uncertain-significance	Non coding transcript variant, coding sequence variant, missense variant
rs2066464	T>C	Conflicting-interpretations-of-pathogenicity	Intron variant, non coding transcript variant
rs34279942	G>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, missense variant, non coding transcript variant
rs45449298	C>A,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, non coding transcript variant
rs45590836	C>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs79157191	G>A,T	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, synonymous variant, coding sequence variant
rs115049252	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, intron variant, coding sequence variant
rs121434294	G>A	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs121434295	C>T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs121434296	G>A	Likely-pathogenic, pathogenic, uncertain-significance	Non coding transcript variant, missense variant, coding sequence variant
rs121434297	A>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs138189536	G>A	Pathogenic, likely-benign	5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant
rs139645527	C>A,G	Conflicting-interpretations-of-pathogenicity, pathogenic	Stop gained, non coding transcript variant, missense variant, coding sequence variant
rs140277700	G>A	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs142612062	T>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, missense variant
rs142617551	T>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, non coding transcript variant, missense variant
rs144921426	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, non coding transcript variant
rs147257424	C>A,G,T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs150847674	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant
rs200100285	T>C,G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs200137991	C>A,G,T	Pathogenic	Missense variant, stop gained, coding sequence variant, non coding transcript variant
rs267606886	A>C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs267606887	T>C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs367585605	C>A,T	Pathogenic, uncertain-significance	Non coding transcript variant, coding sequence variant, synonymous variant
rs368321176	A>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs373398993	A>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs377443637	G>A	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs543016186	C>G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs574132670	C>T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs746353274	TTC>-	Pathogenic	Coding sequence variant, inframe deletion, non coding transcript variant
rs747846362	C>A	Pathogenic	Splice donor variant
rs748571395	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs749765738	A>C,G	Pathogenic	Splice donor variant
rs750323424	C>T	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs754980119	C>G,T	Pathogenic	5 prime UTR variant, coding sequence variant, non coding transcript variant, missense variant
rs758206023	G>A,C	Pathogenic	Intron variant, coding sequence variant, missense variant
rs759031330	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs763539350	G>A,C	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant, 5 prime UTR variant, missense variant
rs765586205	C>T	Pathogenic	Non coding transcript variant, synonymous variant, coding sequence variant
rs769381688	G>A	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs769953411	C>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs776483190	C>G,T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant, 5 prime UTR variant
rs776734688	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant, 5 prime UTR variant, initiator codon variant
rs776969786	G>A,C	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant, 5 prime UTR variant, stop gained
rs777661576	C>T	Pathogenic	Intron variant
rs780014899	T>-	Pathogenic	Splice acceptor variant
rs786204007	C>G,T	Pathogenic	Missense variant, coding sequence variant, stop gained, 5 prime UTR variant, non coding transcript variant
rs786204009	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant, 5 prime UTR variant
rs786204010	->TCACCTGCTGGGTGCCAGGTCACGTCTATGTAGAGGGGG	Pathogenic	Inframe insertion, coding sequence variant, non coding transcript variant
rs786204012	A>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204013	T>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204014	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204016	TGA>-	Pathogenic	Coding sequence variant, inframe deletion, non coding transcript variant
rs786204017	G>A,C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204018	C>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204019	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204020	C>A,T	Pathogenic	Splice donor variant
rs786204021	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204022	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204023	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204024	T>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204026	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204027	A>C,G	Pathogenic	Splice donor variant
rs786204028	C>A,T	Pathogenic, not-provided	Missense variant, coding sequence variant, non coding transcript variant
rs786204030	C>T	Pathogenic, risk-factor	Coding sequence variant, stop gained, non coding transcript variant
rs786204031	A>C,G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204034	A>G	Pathogenic	Missense variant, coding sequence variant, intron variant
rs786204035	CA>AC	Pathogenic	Coding sequence variant, intron variant, stop gained, inframe indel
rs786204037	A>G,T	Pathogenic	Missense variant, coding sequence variant, intron variant
rs986604359	G>A	Pathogenic	Stop gained, coding sequence variant, 5 prime UTR variant, non coding transcript variant
rs1057519359	C>T	Pathogenic	Splice donor variant
rs1057519360	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1057519361	G>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1057519362	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1057519363	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1553185069	A>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1553185497	C>T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1553187509	C>A	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant, 5 prime UTR variant
rs1553188112	AG>-	Pathogenic	Intron variant
rs1557761665	->C	Likely-pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant

Show/Hide all(820)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027114	hsa-miR-103a-3p	Sequencing	20371350
MIRT031648	hsa-miR-16-5p	Sequencing	20371350
MIRT042604	hsa-miR-423-3p	CLASH	23622248
MIRT618790	hsa-miR-1972	HITS-CLIP	23824327
MIRT618789	hsa-miR-4480	HITS-CLIP	23824327
MIRT618788	hsa-miR-3978	HITS-CLIP	23824327
MIRT550618	hsa-miR-4318	PAR-CLIP	21572407
MIRT550619	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT550617	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031648	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT550616	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT550615	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT550614	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT550613	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT550611	hsa-miR-4476	PAR-CLIP	21572407
MIRT550612	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT550610	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT550609	hsa-miR-6814-5p	PAR-CLIP	21572407
MIRT550608	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT550607	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT550606	hsa-miR-7154-3p	PAR-CLIP	21572407
MIRT550605	hsa-miR-765	PAR-CLIP	21572407
MIRT550604	hsa-miR-6894-5p	PAR-CLIP	21572407
MIRT550603	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT472857	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT472855	hsa-miR-764	PAR-CLIP	23592263
MIRT472854	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT472853	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT472852	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT472851	hsa-miR-5698	PAR-CLIP	23592263
MIRT472850	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT472848	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT472849	hsa-miR-4525	PAR-CLIP	23592263
MIRT472847	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT472846	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT472845	hsa-miR-4447	PAR-CLIP	23592263
MIRT472844	hsa-miR-4472	PAR-CLIP	23592263
MIRT472843	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT734975	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	28045918
MIRT731665	hsa-miR-149-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	28045918
MIRT731665	hsa-miR-149-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	28045918
MIRT734975	hsa-miR-22-3p	Luciferase reporter assay, Immunoprecipitaion (IP), Immunofluorescence, Flow cytometry	33168819
MIRT618790	hsa-miR-1972	HITS-CLIP	23824327
MIRT618789	hsa-miR-4480	HITS-CLIP	23824327
MIRT618788	hsa-miR-3978	HITS-CLIP	23824327
MIRT550618	hsa-miR-4318	PAR-CLIP	21572407
MIRT550619	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT550617	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031648	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT550616	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT550615	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT550614	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT550613	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT550611	hsa-miR-4476	PAR-CLIP	21572407
MIRT550612	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT550610	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT550609	hsa-miR-6814-5p	PAR-CLIP	21572407
MIRT550608	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT550607	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT550606	hsa-miR-7154-3p	PAR-CLIP	21572407
MIRT550605	hsa-miR-765	PAR-CLIP	21572407
MIRT550604	hsa-miR-6894-5p	PAR-CLIP	21572407
MIRT550603	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT472857	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT472855	hsa-miR-764	PAR-CLIP	23592263
MIRT472854	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT472853	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT472852	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT472851	hsa-miR-5698	PAR-CLIP	23592263
MIRT472850	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT472848	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT472849	hsa-miR-4525	PAR-CLIP	23592263
MIRT472847	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT472846	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT472845	hsa-miR-4447	PAR-CLIP	23592263
MIRT472844	hsa-miR-4472	PAR-CLIP	23592263
MIRT472843	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT734975	hsa-miR-22-3p	Luciferase reporter assay, Western blotting	37799388
MIRT1163290	hsa-miR-103a	CLIP-seq
MIRT1163291	hsa-miR-103b	CLIP-seq
MIRT1163292	hsa-miR-107	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163294	hsa-miR-1197	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT1163296	hsa-miR-1202	CLIP-seq
MIRT1163297	hsa-miR-1207-3p	CLIP-seq
MIRT1163298	hsa-miR-1224-3p	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT1163300	hsa-miR-1245	CLIP-seq
MIRT1163301	hsa-miR-1245b-3p	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT1163303	hsa-miR-1260	CLIP-seq
MIRT1163304	hsa-miR-1260b	CLIP-seq
MIRT1163305	hsa-miR-1266	CLIP-seq
MIRT1163306	hsa-miR-1275	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT1163308	hsa-miR-1280	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT1163310	hsa-miR-1292	CLIP-seq
MIRT1163311	hsa-miR-129-3p	CLIP-seq
MIRT1163312	hsa-miR-1297	CLIP-seq
MIRT1163313	hsa-miR-182	CLIP-seq
MIRT1163314	hsa-miR-185	CLIP-seq
MIRT1163315	hsa-miR-18a	CLIP-seq
MIRT1163316	hsa-miR-18b	CLIP-seq
MIRT1163317	hsa-miR-1909	CLIP-seq
MIRT1163318	hsa-miR-200b	CLIP-seq
MIRT1163319	hsa-miR-200c	CLIP-seq
MIRT1163320	hsa-miR-26a	CLIP-seq
MIRT1163321	hsa-miR-26b	CLIP-seq
MIRT1163322	hsa-miR-2861	CLIP-seq
MIRT1163323	hsa-miR-296-5p	CLIP-seq
MIRT1163324	hsa-miR-3140-5p	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT1163326	hsa-miR-3148	CLIP-seq
MIRT1163327	hsa-miR-3158-3p	CLIP-seq
MIRT1163328	hsa-miR-3170	CLIP-seq
MIRT1163329	hsa-miR-3175	CLIP-seq
MIRT1163330	hsa-miR-3176	CLIP-seq
MIRT1163331	hsa-miR-3180-5p	CLIP-seq
MIRT1163332	hsa-miR-3183	CLIP-seq
MIRT1163333	hsa-miR-3184	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT1163335	hsa-miR-3194-3p	CLIP-seq
MIRT1163336	hsa-miR-3198	CLIP-seq
MIRT1163337	hsa-miR-320e	CLIP-seq
MIRT1163338	hsa-miR-326	CLIP-seq
MIRT1163339	hsa-miR-330-5p	CLIP-seq
MIRT1163340	hsa-miR-339-3p	CLIP-seq
MIRT1163341	hsa-miR-3609	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT1163343	hsa-miR-3651	CLIP-seq
MIRT1163344	hsa-miR-3663-5p	CLIP-seq
MIRT1163345	hsa-miR-3664-3p	CLIP-seq
MIRT1163346	hsa-miR-3689d	CLIP-seq
MIRT1163347	hsa-miR-3922-3p	CLIP-seq
MIRT1163348	hsa-miR-3934	CLIP-seq
MIRT1163349	hsa-miR-3944-5p	CLIP-seq
MIRT1163350	hsa-miR-3972	CLIP-seq
MIRT1163351	hsa-miR-423-5p	CLIP-seq
MIRT1163352	hsa-miR-425	CLIP-seq
MIRT1163353	hsa-miR-4259	CLIP-seq
MIRT1163354	hsa-miR-4274	CLIP-seq
MIRT1163355	hsa-miR-4279	CLIP-seq
MIRT1163356	hsa-miR-429	CLIP-seq
MIRT1163357	hsa-miR-4294	CLIP-seq
MIRT1163358	hsa-miR-4299	CLIP-seq
MIRT1163359	hsa-miR-4306	CLIP-seq
MIRT1163360	hsa-miR-4309	CLIP-seq
MIRT1163361	hsa-miR-4313	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT1163364	hsa-miR-4330	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT1163366	hsa-miR-4423-5p	CLIP-seq
MIRT1163367	hsa-miR-4433	CLIP-seq
MIRT1163368	hsa-miR-4435	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT1163370	hsa-miR-4446-3p	CLIP-seq
MIRT1163371	hsa-miR-4456	CLIP-seq
MIRT1163372	hsa-miR-4459	CLIP-seq
MIRT1163373	hsa-miR-4465	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT1163375	hsa-miR-4469	CLIP-seq
MIRT1163376	hsa-miR-4485	CLIP-seq
MIRT1163377	hsa-miR-4488	CLIP-seq
MIRT1163378	hsa-miR-4494	CLIP-seq
MIRT1163379	hsa-miR-4512	CLIP-seq
MIRT1163380	hsa-miR-4518	CLIP-seq
MIRT1163381	hsa-miR-4519	CLIP-seq
MIRT1163382	hsa-miR-4522	CLIP-seq
MIRT1163383	hsa-miR-4532	CLIP-seq
MIRT1163384	hsa-miR-4539	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT1163387	hsa-miR-4640-3p	CLIP-seq
MIRT1163388	hsa-miR-4641	CLIP-seq
MIRT1163389	hsa-miR-4644	CLIP-seq
MIRT1163390	hsa-miR-4650-5p	CLIP-seq
MIRT1163391	hsa-miR-4651	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT1163393	hsa-miR-4656	CLIP-seq
MIRT1163394	hsa-miR-4659a-5p	CLIP-seq
MIRT1163395	hsa-miR-4659b-5p	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT1163397	hsa-miR-4680-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT1163399	hsa-miR-4687-5p	CLIP-seq
MIRT1163400	hsa-miR-4695-3p	CLIP-seq
MIRT1163401	hsa-miR-4697-5p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT1163403	hsa-miR-4704-5p	CLIP-seq
MIRT1163404	hsa-miR-4711-5p	CLIP-seq
MIRT1163405	hsa-miR-4714-3p	CLIP-seq
MIRT1163406	hsa-miR-4715-3p	CLIP-seq
MIRT1163407	hsa-miR-4715-5p	CLIP-seq
MIRT1163408	hsa-miR-4723-3p	CLIP-seq
MIRT1163409	hsa-miR-4727-5p	CLIP-seq
MIRT1163410	hsa-miR-4735-3p	CLIP-seq
MIRT1163411	hsa-miR-4755-3p	CLIP-seq
MIRT1163412	hsa-miR-4768-3p	CLIP-seq
MIRT1163413	hsa-miR-4769-3p	CLIP-seq
MIRT1163414	hsa-miR-4772-3p	CLIP-seq
MIRT1163415	hsa-miR-4776-3p	CLIP-seq
MIRT1163416	hsa-miR-4781-3p	CLIP-seq
MIRT1163417	hsa-miR-4786-3p	CLIP-seq
MIRT1163418	hsa-miR-4787-5p	CLIP-seq
MIRT1163419	hsa-miR-4802-5p	CLIP-seq
MIRT1163420	hsa-miR-486-3p	CLIP-seq
MIRT1163421	hsa-miR-499a-5p	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT1163425	hsa-miR-532-3p	CLIP-seq
MIRT1163426	hsa-miR-543	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT1163428	hsa-miR-548ah	CLIP-seq
MIRT1163429	hsa-miR-548q	CLIP-seq
MIRT1163430	hsa-miR-548t	CLIP-seq
MIRT1163431	hsa-miR-548v	CLIP-seq
MIRT1163432	hsa-miR-556-3p	CLIP-seq
MIRT1163433	hsa-miR-579	CLIP-seq
MIRT1163434	hsa-miR-608	CLIP-seq
MIRT1163435	hsa-miR-614	CLIP-seq
MIRT1163436	hsa-miR-622	CLIP-seq
MIRT1163437	hsa-miR-625	CLIP-seq
MIRT1163438	hsa-miR-637	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT1163441	hsa-miR-665	CLIP-seq
MIRT1163442	hsa-miR-671-5p	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT1163445	hsa-miR-767-3p	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163297	hsa-miR-1207-3p	CLIP-seq
MIRT2046896	hsa-miR-1207-5p	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT2046897	hsa-miR-1254	CLIP-seq
MIRT1163305	hsa-miR-1266	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT2046898	hsa-miR-1287	CLIP-seq
MIRT2046899	hsa-miR-1291	CLIP-seq
MIRT2046900	hsa-miR-1293	CLIP-seq
MIRT1163312	hsa-miR-1297	CLIP-seq
MIRT2046901	hsa-miR-1343	CLIP-seq
MIRT2046902	hsa-miR-138	CLIP-seq
MIRT2046903	hsa-miR-148a	CLIP-seq
MIRT2046904	hsa-miR-148b	CLIP-seq
MIRT2046905	hsa-miR-149	CLIP-seq
MIRT2046906	hsa-miR-152	CLIP-seq
MIRT2046907	hsa-miR-15a	CLIP-seq
MIRT2046908	hsa-miR-15b	CLIP-seq
MIRT2046909	hsa-miR-16	CLIP-seq
MIRT2046910	hsa-miR-1825	CLIP-seq
MIRT2046911	hsa-miR-184	CLIP-seq
MIRT1163314	hsa-miR-185	CLIP-seq
MIRT2046912	hsa-miR-1910	CLIP-seq
MIRT2046913	hsa-miR-1913	CLIP-seq
MIRT2046914	hsa-miR-195	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT2046916	hsa-miR-214	CLIP-seq
MIRT2046917	hsa-miR-22	CLIP-seq
MIRT2046918	hsa-miR-223	CLIP-seq
MIRT2046919	hsa-miR-2278	CLIP-seq
MIRT2046920	hsa-miR-24	CLIP-seq
MIRT1163320	hsa-miR-26a	CLIP-seq
MIRT1163321	hsa-miR-26b	CLIP-seq
MIRT1163322	hsa-miR-2861	CLIP-seq
MIRT2046921	hsa-miR-3064-3p	CLIP-seq
MIRT2046922	hsa-miR-3116	CLIP-seq
MIRT2046923	hsa-miR-3135b	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2046925	hsa-miR-3150a-5p	CLIP-seq
MIRT2046926	hsa-miR-3150b-5p	CLIP-seq
MIRT1163327	hsa-miR-3158-3p	CLIP-seq
MIRT2046927	hsa-miR-3189-5p	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT2046928	hsa-miR-3202	CLIP-seq
MIRT2046929	hsa-miR-324-3p	CLIP-seq
MIRT1163338	hsa-miR-326	CLIP-seq
MIRT1163339	hsa-miR-330-5p	CLIP-seq
MIRT2046930	hsa-miR-34a	CLIP-seq
MIRT2046931	hsa-miR-34c-5p	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT2046932	hsa-miR-3619-5p	CLIP-seq
MIRT2046933	hsa-miR-3622b-5p	CLIP-seq
MIRT2046934	hsa-miR-365	CLIP-seq
MIRT2046935	hsa-miR-3925-3p	CLIP-seq
MIRT1163348	hsa-miR-3934	CLIP-seq
MIRT1163349	hsa-miR-3944-5p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2046937	hsa-miR-424	CLIP-seq
MIRT2046938	hsa-miR-4258	CLIP-seq
MIRT1163353	hsa-miR-4259	CLIP-seq
MIRT2046939	hsa-miR-4267	CLIP-seq
MIRT2046940	hsa-miR-4277	CLIP-seq
MIRT2046941	hsa-miR-4290	CLIP-seq
MIRT1163359	hsa-miR-4306	CLIP-seq
MIRT2046942	hsa-miR-4307	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2046943	hsa-miR-4428	CLIP-seq
MIRT2046944	hsa-miR-4437	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT1163373	hsa-miR-4465	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2046945	hsa-miR-4483	CLIP-seq
MIRT2046946	hsa-miR-4487	CLIP-seq
MIRT2046947	hsa-miR-449a	CLIP-seq
MIRT2046948	hsa-miR-449b	CLIP-seq
MIRT2046949	hsa-miR-4514	CLIP-seq
MIRT1163380	hsa-miR-4518	CLIP-seq
MIRT2046950	hsa-miR-4530	CLIP-seq
MIRT1163383	hsa-miR-4532	CLIP-seq
MIRT2046951	hsa-miR-4638-3p	CLIP-seq
MIRT1163388	hsa-miR-4641	CLIP-seq
MIRT1163389	hsa-miR-4644	CLIP-seq
MIRT1163391	hsa-miR-4651	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT2046952	hsa-miR-4653-3p	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT2046953	hsa-miR-4676-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT2046954	hsa-miR-4688	CLIP-seq
MIRT2046955	hsa-miR-4690-5p	CLIP-seq
MIRT2046956	hsa-miR-4692	CLIP-seq
MIRT2046957	hsa-miR-4693-3p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT2046958	hsa-miR-4713-5p	CLIP-seq
MIRT1163407	hsa-miR-4715-5p	CLIP-seq
MIRT2046959	hsa-miR-4717-5p	CLIP-seq
MIRT2046960	hsa-miR-4721	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046962	hsa-miR-4728-5p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2046964	hsa-miR-4747-5p	CLIP-seq
MIRT2046965	hsa-miR-4749-3p	CLIP-seq
MIRT1163411	hsa-miR-4755-3p	CLIP-seq
MIRT2046966	hsa-miR-4758-3p	CLIP-seq
MIRT2046967	hsa-miR-4763-3p	CLIP-seq
MIRT2046968	hsa-miR-4765	CLIP-seq
MIRT1163413	hsa-miR-4769-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046971	hsa-miR-4804-5p	CLIP-seq
MIRT2046972	hsa-miR-483-3p	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046974	hsa-miR-485-5p	CLIP-seq
MIRT1163420	hsa-miR-486-3p	CLIP-seq
MIRT2046975	hsa-miR-497	CLIP-seq
MIRT2046976	hsa-miR-508-5p	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT2046978	hsa-miR-515-3p	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT2046982	hsa-miR-519e	CLIP-seq
MIRT1163429	hsa-miR-548q	CLIP-seq
MIRT2046983	hsa-miR-575	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163434	hsa-miR-608	CLIP-seq
MIRT2046985	hsa-miR-646	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT2046986	hsa-miR-744	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046987	hsa-miR-760	CLIP-seq
MIRT2046988	hsa-miR-761	CLIP-seq
MIRT2046989	hsa-miR-766	CLIP-seq
MIRT2046990	hsa-miR-875-3p	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT2276002	hsa-miR-1236	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT2046897	hsa-miR-1254	CLIP-seq
MIRT1163305	hsa-miR-1266	CLIP-seq
MIRT1163306	hsa-miR-1275	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT2046900	hsa-miR-1293	CLIP-seq
MIRT1163312	hsa-miR-1297	CLIP-seq
MIRT2046905	hsa-miR-149	CLIP-seq
MIRT2046907	hsa-miR-15a	CLIP-seq
MIRT2046908	hsa-miR-15b	CLIP-seq
MIRT2046909	hsa-miR-16	CLIP-seq
MIRT2046912	hsa-miR-1910	CLIP-seq
MIRT2046913	hsa-miR-1913	CLIP-seq
MIRT2276003	hsa-miR-1915	CLIP-seq
MIRT2046914	hsa-miR-195	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT1163318	hsa-miR-200b	CLIP-seq
MIRT1163319	hsa-miR-200c	CLIP-seq
MIRT2046916	hsa-miR-214	CLIP-seq
MIRT2046917	hsa-miR-22	CLIP-seq
MIRT2046920	hsa-miR-24	CLIP-seq
MIRT1163320	hsa-miR-26a	CLIP-seq
MIRT1163321	hsa-miR-26b	CLIP-seq
MIRT2276004	hsa-miR-28-5p	CLIP-seq
MIRT2046922	hsa-miR-3116	CLIP-seq
MIRT2276005	hsa-miR-3120-3p	CLIP-seq
MIRT2276006	hsa-miR-3139	CLIP-seq
MIRT1163326	hsa-miR-3148	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT1163327	hsa-miR-3158-3p	CLIP-seq
MIRT1163330	hsa-miR-3176	CLIP-seq
MIRT2046927	hsa-miR-3189-5p	CLIP-seq
MIRT2276007	hsa-miR-3199	CLIP-seq
MIRT2046929	hsa-miR-324-3p	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT2046932	hsa-miR-3619-5p	CLIP-seq
MIRT2276008	hsa-miR-3664-5p	CLIP-seq
MIRT2276009	hsa-miR-3667-3p	CLIP-seq
MIRT2276010	hsa-miR-3690	CLIP-seq
MIRT2276011	hsa-miR-374c	CLIP-seq
MIRT1163347	hsa-miR-3922-3p	CLIP-seq
MIRT2276012	hsa-miR-3942-3p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2046937	hsa-miR-424	CLIP-seq
MIRT2276013	hsa-miR-4254	CLIP-seq
MIRT2046938	hsa-miR-4258	CLIP-seq
MIRT1163353	hsa-miR-4259	CLIP-seq
MIRT1163356	hsa-miR-429	CLIP-seq
MIRT2276014	hsa-miR-4297	CLIP-seq
MIRT2276015	hsa-miR-4312	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2276016	hsa-miR-4426	CLIP-seq
MIRT2046943	hsa-miR-4428	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT2276017	hsa-miR-4457	CLIP-seq
MIRT1163373	hsa-miR-4465	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2046945	hsa-miR-4483	CLIP-seq
MIRT1163380	hsa-miR-4518	CLIP-seq
MIRT1163383	hsa-miR-4532	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT2276018	hsa-miR-4645-5p	CLIP-seq
MIRT2276019	hsa-miR-4647	CLIP-seq
MIRT2276020	hsa-miR-4662b	CLIP-seq
MIRT2276021	hsa-miR-4667-3p	CLIP-seq
MIRT2276022	hsa-miR-4673	CLIP-seq
MIRT2046953	hsa-miR-4676-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT2046958	hsa-miR-4713-5p	CLIP-seq
MIRT1163407	hsa-miR-4715-5p	CLIP-seq
MIRT2046960	hsa-miR-4721	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2276023	hsa-miR-4742-5p	CLIP-seq
MIRT1163411	hsa-miR-4755-3p	CLIP-seq
MIRT2046966	hsa-miR-4758-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046974	hsa-miR-485-5p	CLIP-seq
MIRT2046975	hsa-miR-497	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT2276024	hsa-miR-516a-3p	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT1163432	hsa-miR-556-3p	CLIP-seq
MIRT2276025	hsa-miR-558	CLIP-seq
MIRT2046983	hsa-miR-575	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT2276026	hsa-miR-655	CLIP-seq
MIRT2276027	hsa-miR-659	CLIP-seq
MIRT1163441	hsa-miR-665	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT2276028	hsa-miR-708	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046987	hsa-miR-760	CLIP-seq
MIRT2046988	hsa-miR-761	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT2276029	hsa-miR-935	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT2391153	hsa-miR-3156-5p	CLIP-seq
MIRT2391154	hsa-miR-3185	CLIP-seq
MIRT2276007	hsa-miR-3199	CLIP-seq
MIRT2391155	hsa-miR-3688-5p	CLIP-seq
MIRT2391156	hsa-miR-421	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT2391157	hsa-miR-4328	CLIP-seq
MIRT1163368	hsa-miR-4435	CLIP-seq
MIRT2391158	hsa-miR-450a	CLIP-seq
MIRT2391159	hsa-miR-4709-5p	CLIP-seq
MIRT2276024	hsa-miR-516a-3p	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT2391160	hsa-miR-644	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2574865	hsa-let-7a	CLIP-seq
MIRT2574866	hsa-let-7b	CLIP-seq
MIRT2574867	hsa-let-7c	CLIP-seq
MIRT2574868	hsa-let-7d	CLIP-seq
MIRT2574869	hsa-let-7e	CLIP-seq
MIRT2574870	hsa-let-7f	CLIP-seq
MIRT2574871	hsa-let-7g	CLIP-seq
MIRT2574872	hsa-let-7i	CLIP-seq
MIRT1163290	hsa-miR-103a	CLIP-seq
MIRT1163291	hsa-miR-103b	CLIP-seq
MIRT1163292	hsa-miR-107	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT2046896	hsa-miR-1207-5p	CLIP-seq
MIRT2574873	hsa-miR-1225-3p	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT2574874	hsa-miR-1253	CLIP-seq
MIRT2574875	hsa-miR-1270	CLIP-seq
MIRT2574876	hsa-miR-1273f	CLIP-seq
MIRT2574877	hsa-miR-127-3p	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT1163311	hsa-miR-129-3p	CLIP-seq
MIRT2574878	hsa-miR-1294	CLIP-seq
MIRT2574879	hsa-miR-129-5p	CLIP-seq
MIRT2574880	hsa-miR-1303	CLIP-seq
MIRT2574881	hsa-miR-142-3p	CLIP-seq
MIRT2574882	hsa-miR-143	CLIP-seq
MIRT2574883	hsa-miR-1539	CLIP-seq
MIRT1163314	hsa-miR-185	CLIP-seq
MIRT2574884	hsa-miR-186	CLIP-seq
MIRT2574885	hsa-miR-1911	CLIP-seq
MIRT2276003	hsa-miR-1915	CLIP-seq
MIRT2574886	hsa-miR-193a-3p	CLIP-seq
MIRT2574887	hsa-miR-193b	CLIP-seq
MIRT2574888	hsa-miR-196a	CLIP-seq
MIRT2574889	hsa-miR-196b	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT2574890	hsa-miR-202	CLIP-seq
MIRT2574891	hsa-miR-2052	CLIP-seq
MIRT2046916	hsa-miR-214	CLIP-seq
MIRT2574892	hsa-miR-217	CLIP-seq
MIRT2046920	hsa-miR-24	CLIP-seq
MIRT1163322	hsa-miR-2861	CLIP-seq
MIRT2046921	hsa-miR-3064-3p	CLIP-seq
MIRT2574893	hsa-miR-3117-5p	CLIP-seq
MIRT2276005	hsa-miR-3120-3p	CLIP-seq
MIRT2574894	hsa-miR-3123	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2574895	hsa-miR-3152-5p	CLIP-seq
MIRT2391153	hsa-miR-3156-5p	CLIP-seq
MIRT2574896	hsa-miR-3161	CLIP-seq
MIRT1163329	hsa-miR-3175	CLIP-seq
MIRT2574897	hsa-miR-3177-3p	CLIP-seq
MIRT1163332	hsa-miR-3183	CLIP-seq
MIRT2391154	hsa-miR-3185	CLIP-seq
MIRT2046927	hsa-miR-3189-5p	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT2574898	hsa-miR-3192	CLIP-seq
MIRT2574899	hsa-miR-3193	CLIP-seq
MIRT1163335	hsa-miR-3194-3p	CLIP-seq
MIRT1163340	hsa-miR-339-3p	CLIP-seq
MIRT2574900	hsa-miR-3613-3p	CLIP-seq
MIRT2046932	hsa-miR-3619-5p	CLIP-seq
MIRT2574901	hsa-miR-3622a-3p	CLIP-seq
MIRT2574902	hsa-miR-3622b-3p	CLIP-seq
MIRT1163343	hsa-miR-3651	CLIP-seq
MIRT2574903	hsa-miR-3657	CLIP-seq
MIRT2574904	hsa-miR-3662	CLIP-seq
MIRT2276008	hsa-miR-3664-5p	CLIP-seq
MIRT2574905	hsa-miR-3665	CLIP-seq
MIRT2574906	hsa-miR-3672	CLIP-seq
MIRT2574907	hsa-miR-3676	CLIP-seq
MIRT2574908	hsa-miR-3691-3p	CLIP-seq
MIRT2574909	hsa-miR-3921	CLIP-seq
MIRT2574910	hsa-miR-3925-5p	CLIP-seq
MIRT2276012	hsa-miR-3942-3p	CLIP-seq
MIRT2574911	hsa-miR-3943	CLIP-seq
MIRT1163349	hsa-miR-3944-5p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2391156	hsa-miR-421	CLIP-seq
MIRT1163352	hsa-miR-425	CLIP-seq
MIRT2574912	hsa-miR-4263	CLIP-seq
MIRT2046939	hsa-miR-4267	CLIP-seq
MIRT2574913	hsa-miR-4269	CLIP-seq
MIRT2574914	hsa-miR-4271	CLIP-seq
MIRT1163354	hsa-miR-4274	CLIP-seq
MIRT2574915	hsa-miR-4283	CLIP-seq
MIRT2574916	hsa-miR-4284	CLIP-seq
MIRT2574917	hsa-miR-4291	CLIP-seq
MIRT1163358	hsa-miR-4299	CLIP-seq
MIRT1163359	hsa-miR-4306	CLIP-seq
MIRT1163361	hsa-miR-4313	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2574918	hsa-miR-4420	CLIP-seq
MIRT2046944	hsa-miR-4437	CLIP-seq
MIRT2574919	hsa-miR-4438	CLIP-seq
MIRT1163371	hsa-miR-4456	CLIP-seq
MIRT2574920	hsa-miR-4458	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT1163375	hsa-miR-4469	CLIP-seq
MIRT1163378	hsa-miR-4494	CLIP-seq
MIRT2574921	hsa-miR-4500	CLIP-seq
MIRT1163379	hsa-miR-4512	CLIP-seq
MIRT1163381	hsa-miR-4519	CLIP-seq
MIRT2574922	hsa-miR-451b	CLIP-seq
MIRT1163382	hsa-miR-4522	CLIP-seq
MIRT2046950	hsa-miR-4530	CLIP-seq
MIRT2574923	hsa-miR-4531	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT1163387	hsa-miR-4640-3p	CLIP-seq
MIRT1163388	hsa-miR-4641	CLIP-seq
MIRT2574924	hsa-miR-4643	CLIP-seq
MIRT1163389	hsa-miR-4644	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT2574925	hsa-miR-4653-5p	CLIP-seq
MIRT1163394	hsa-miR-4659a-5p	CLIP-seq
MIRT1163395	hsa-miR-4659b-5p	CLIP-seq
MIRT2574926	hsa-miR-4661-5p	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT2574927	hsa-miR-4682	CLIP-seq
MIRT1163399	hsa-miR-4687-5p	CLIP-seq
MIRT2574928	hsa-miR-4699-5p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT1163403	hsa-miR-4704-5p	CLIP-seq
MIRT2574929	hsa-miR-4708-5p	CLIP-seq
MIRT2574930	hsa-miR-4709-3p	CLIP-seq
MIRT2391159	hsa-miR-4709-5p	CLIP-seq
MIRT2574931	hsa-miR-4710	CLIP-seq
MIRT1163405	hsa-miR-4714-3p	CLIP-seq
MIRT1163406	hsa-miR-4715-3p	CLIP-seq
MIRT2574932	hsa-miR-4716-3p	CLIP-seq
MIRT1163408	hsa-miR-4723-3p	CLIP-seq
MIRT2574933	hsa-miR-4725-3p	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2574934	hsa-miR-4736	CLIP-seq
MIRT2046966	hsa-miR-4758-3p	CLIP-seq
MIRT2046967	hsa-miR-4763-3p	CLIP-seq
MIRT2574935	hsa-miR-4770	CLIP-seq
MIRT2574936	hsa-miR-4774-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT1163415	hsa-miR-4776-3p	CLIP-seq
MIRT1163417	hsa-miR-4786-3p	CLIP-seq
MIRT1163418	hsa-miR-4787-5p	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT1163419	hsa-miR-4802-5p	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2574937	hsa-miR-486-5p	CLIP-seq
MIRT1163421	hsa-miR-499a-5p	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT2574938	hsa-miR-5095	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT1163429	hsa-miR-548q	CLIP-seq
MIRT1163433	hsa-miR-579	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT2574939	hsa-miR-620	CLIP-seq
MIRT1163436	hsa-miR-622	CLIP-seq
MIRT1163437	hsa-miR-625	CLIP-seq
MIRT1163438	hsa-miR-637	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046988	hsa-miR-761	CLIP-seq
MIRT1163445	hsa-miR-767-3p	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT2574940	hsa-miR-892b	CLIP-seq
MIRT2574941	hsa-miR-922	CLIP-seq
MIRT2276029	hsa-miR-935	CLIP-seq
MIRT2574942	hsa-miR-938	CLIP-seq
MIRT2574943	hsa-miR-941	CLIP-seq
MIRT2574944	hsa-miR-98	CLIP-seq
MIRT2574865	hsa-let-7a	CLIP-seq
MIRT2574866	hsa-let-7b	CLIP-seq
MIRT2574867	hsa-let-7c	CLIP-seq
MIRT2574868	hsa-let-7d	CLIP-seq
MIRT2574869	hsa-let-7e	CLIP-seq
MIRT2574870	hsa-let-7f	CLIP-seq
MIRT2574871	hsa-let-7g	CLIP-seq
MIRT2574872	hsa-let-7i	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163294	hsa-miR-1197	CLIP-seq
MIRT2046896	hsa-miR-1207-5p	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT2574878	hsa-miR-1294	CLIP-seq
MIRT2685481	hsa-miR-1301	CLIP-seq
MIRT2685482	hsa-miR-134	CLIP-seq
MIRT2574881	hsa-miR-142-3p	CLIP-seq
MIRT2046905	hsa-miR-149	CLIP-seq
MIRT2276003	hsa-miR-1915	CLIP-seq
MIRT2574886	hsa-miR-193a-3p	CLIP-seq
MIRT2574887	hsa-miR-193b	CLIP-seq
MIRT2574888	hsa-miR-196a	CLIP-seq
MIRT2574889	hsa-miR-196b	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT2574890	hsa-miR-202	CLIP-seq
MIRT2574891	hsa-miR-2052	CLIP-seq
MIRT2574892	hsa-miR-217	CLIP-seq
MIRT2046921	hsa-miR-3064-3p	CLIP-seq
MIRT2574893	hsa-miR-3117-5p	CLIP-seq
MIRT2685483	hsa-miR-3118	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2574895	hsa-miR-3152-5p	CLIP-seq
MIRT2391153	hsa-miR-3156-5p	CLIP-seq
MIRT2574896	hsa-miR-3161	CLIP-seq
MIRT2685484	hsa-miR-3164	CLIP-seq
MIRT2574897	hsa-miR-3177-3p	CLIP-seq
MIRT2391154	hsa-miR-3185	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT2574898	hsa-miR-3192	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT2574900	hsa-miR-3613-3p	CLIP-seq
MIRT2574901	hsa-miR-3622a-3p	CLIP-seq
MIRT2574902	hsa-miR-3622b-3p	CLIP-seq
MIRT2574903	hsa-miR-3657	CLIP-seq
MIRT2574904	hsa-miR-3662	CLIP-seq
MIRT2276008	hsa-miR-3664-5p	CLIP-seq
MIRT2574905	hsa-miR-3665	CLIP-seq
MIRT2574906	hsa-miR-3672	CLIP-seq
MIRT2574907	hsa-miR-3676	CLIP-seq
MIRT2574908	hsa-miR-3691-3p	CLIP-seq
MIRT2685485	hsa-miR-371-5p	CLIP-seq
MIRT2276012	hsa-miR-3942-3p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2391156	hsa-miR-421	CLIP-seq
MIRT1163352	hsa-miR-425	CLIP-seq
MIRT2574914	hsa-miR-4271	CLIP-seq
MIRT1163354	hsa-miR-4274	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2574918	hsa-miR-4420	CLIP-seq
MIRT2046944	hsa-miR-4437	CLIP-seq
MIRT2574919	hsa-miR-4438	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT2574920	hsa-miR-4458	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2574921	hsa-miR-4500	CLIP-seq
MIRT2574922	hsa-miR-451b	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT2685486	hsa-miR-4660	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT2391159	hsa-miR-4709-5p	CLIP-seq
MIRT2574931	hsa-miR-4710	CLIP-seq
MIRT1163405	hsa-miR-4714-3p	CLIP-seq
MIRT1163406	hsa-miR-4715-3p	CLIP-seq
MIRT2574932	hsa-miR-4716-3p	CLIP-seq
MIRT2574933	hsa-miR-4725-3p	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2574934	hsa-miR-4736	CLIP-seq
MIRT2046967	hsa-miR-4763-3p	CLIP-seq
MIRT2574936	hsa-miR-4774-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT1163417	hsa-miR-4786-3p	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046974	hsa-miR-485-5p	CLIP-seq
MIRT2574937	hsa-miR-486-5p	CLIP-seq
MIRT2685487	hsa-miR-5047	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT2574938	hsa-miR-5095	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163436	hsa-miR-622	CLIP-seq
MIRT1163437	hsa-miR-625	CLIP-seq
MIRT1163438	hsa-miR-637	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046987	hsa-miR-760	CLIP-seq
MIRT2574940	hsa-miR-892b	CLIP-seq
MIRT2574942	hsa-miR-938	CLIP-seq
MIRT2574943	hsa-miR-941	CLIP-seq
MIRT2574944	hsa-miR-98	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
NFE2L2	Activation	16551619

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001843	Process	Neural tube closure	IMP	25855017, 29222906
GO:0001843	Process	Neural tube closure	NAS	9349452
GO:0003824	Function	Catalytic activity	IEA
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IBA
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IDA	12673793, 24769206, 29891918
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IEA
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IGI	10551815
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IMP	12673793, 25736335
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006555	Process	Methionine metabolic process	IEA
GO:0006555	Process	Methionine metabolic process	IGI	10551815
GO:0009086	Process	Methionine biosynthetic process	IBA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0033274	Process	Response to vitamin B2	IEA
GO:0035999	Process	Tetrahydrofolate interconversion	IBA
GO:0035999	Process	Tetrahydrofolate interconversion	IDA	12673793, 29891918
GO:0035999	Process	Tetrahydrofolate interconversion	IEA
GO:0035999	Process	Tetrahydrofolate interconversion	IGI	10551815
GO:0035999	Process	Tetrahydrofolate interconversion	IMP	12673793, 25736335
GO:0043200	Process	Response to amino acid	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	24769206
GO:0046500	Process	S-adenosylmethionine metabolic process	IEA
GO:0046653	Process	Tetrahydrofolate metabolic process	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IDA	12673793
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0050661	Function	NADP binding	IEA
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0050667	Process	Homocysteine metabolic process	IEA
GO:0051593	Process	Response to folic acid	IEA
GO:0070555	Process	Response to interleukin-1	IEA
GO:0070828	Process	Heterochromatin organization	IDA	24769206
GO:0071949	Function	FAD binding	IBA
GO:0072341	Function	Modified amino acid binding	IDA	20031578
GO:0106313	Function	Methylenetetrahydrofolate reductase (NADPH) activity	IEA

MIM	HGNC	e!Ensembl
607093	7436	ENSG00000177000

Protein

UniProt ID

P42898

Protein name

Methylenetetrahydrofolate reductase (NADPH) (EC 1.5.1.53)

Protein function

Catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a cosubstrate for homocysteine remethylation to methionine (PubMed:29891918). Represents a key regulatory connection between the folate and methionine cycles

PDB

6FCX , 8QA4 , 8QA5 , 8QA6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02219	MTHFR	48 → 337	Methylenetetrahydrofolate reductase	Domain

Sequence

MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDPERHERLREKMRRRLESGDKWF
SLEFFPPRTAEGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAVNYC
GLETILHMTCCRQRLEEITGHLHKAKQLGLKNIMALRGDPIGDQWEEEEGGFNYAVDLVK
HIRSEFGDYFDICVAGYPKGHPEAGSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFV
KACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQEIKDVIEPIKDNDAAIRNYGIE
LAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWALSAHPKRREE
DVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKM
WGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGIL
TINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHL
VNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIERWGKLYE
EESPSRTIIQYIHDNYFLVNLVDNDFPLDNCLWQVVEDTLELLNRPTQNARETEAP

Sequence length

656

Interactions

View interactions

	KEGG		Reactome
	One carbon pool by folate Metabolic pathways Antifolate resistance Folate transport and metabolism		Metabolism of folate and pterines

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Homocystinuria	homocystinuria due to methylene tetrahydrofolate reductase deficiency	rs1380686004, rs786204035, rs377443637, rs121434294, rs1644227125, rs786204007, rs777661576, rs780014899, rs121434295, rs139645527, rs1644375837, rs776483190, rs776734688, rs786204013, rs267606887 View all (43 more)	N/A
Neural Tube Defect	Neural tube defects, folate-sensitive	rs763539350, rs200137991, rs574132670, rs140277700, rs377443637, rs777661576, rs780014899, rs139645527, rs776483190, rs786204013, rs747846362, rs750323424, rs986604359, rs121434297, rs147257424 View all (4 more)	N/A
Thrombophilia	Thrombophilia due to thrombin defect	rs574132670	N/A

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Gastrointestinal stromal tumor	gastrointestinal stromal tumor	N/A	N/A	ClinVar
Hypertension	High blood pressure / hypertension, Gestational hypertension, Hypertension	N/A	N/A	GWAS
Leprosy	Leprosy	N/A	N/A	GWAS
Mental retardation	intellectual disability	N/A	N/A	ClinVar
Moyamoya Disease	Moyamoya disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Schizophrenia	schizophrenia, Schizophrenia, susceptibility to	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (534)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormal Karyotype	Associate	31737664
Abnormalities Drug Induced	Associate	36619555
Abortion Habitual	Associate	12738509, 15821810, 24235948, 24484533, 26060483, 27525841, 28703660, 28819944, 29785531, 30680517
Abortion Spontaneous	Associate	11821094, 12623486, 23288205, 25153695, 27068821, 28488549, 28580572, 28703660, 29564022, 32021228, 33914208, 35232413, 36008980, 38057822
Activated Protein C Resistance	Associate	16015408
Acute Coronary Syndrome	Associate	27051002, 29245302, 32160861, 35721657
Acute Disease	Associate	15886665
Acute Febrile Encephalopathy	Associate	16906320
Acute Kidney Injury	Associate	22129510
Adenocarcinoma	Associate	12115343, 24490800
Adenocarcinoma of Lung	Inhibit	25536611
Adenocarcinoma of Lung	Associate	25536611
Adenoma	Associate	16108833, 16985020, 18768511, 31740010
Adenoma Islet Cell	Associate	21462086
Adenomatous Polyposis Coli	Associate	24108782, 34956401
Adrenal Insufficiency	Associate	19123462, 33923969
Adrenoleukodystrophy	Associate	19353223
Age Related Hearing Impairment 1	Associate	21385350
Albuminuria	Associate	21943240
Alopecia Areata	Associate	34752683
Alzheimer Disease	Associate	10860300, 15201366, 17691219, 18628954, 24223459, 24679048, 28342207, 32804129, 33833133
Alzheimer Disease 6	Associate	14603192
Amaurosis Fugax	Associate	16015408
Amputation Congenital	Associate	35450383
Anemia Hemolytic	Associate	19094231
Anemia Megaloblastic	Associate	17908667
Anemia Sickle Cell	Associate	10583261, 11279637, 15224376, 16906320, 22084413, 23869056, 32201547, 37260067, 37895268, 9723576, 9840906
Aneuploidy	Associate	22377705, 26217949, 27068821
Aneurysm	Associate	10957660, 15996600
Aneurysm Ascending Aorta	Associate	19580662
Anodontia	Associate	34348647, 38238653
Antiphospholipid Syndrome	Associate	17895510, 23162020, 31173496
Antithrombin deficiency type 2	Associate	10029588
Aortic Aneurysm Abdominal	Associate	10957660, 15996600, 26017485
Aortic Aneurysm Familial Abdominal 1	Associate	10957660, 26017485
Aortic Aneurysm Familial Thoracic 1	Associate	26017485
Aortic Coarctation	Associate	19764075
Arrest of spermatogenesis	Associate	28440964
Arsenic Poisoning	Associate	31864032, 37929396
Arterial Occlusive Diseases	Associate	10360908, 18293456, 32201547
Arteriosclerosis	Associate	27234992, 37355582
Arthritis Rheumatoid	Associate	11710708, 15361376, 16272757, 16439441, 16572443, 17213520, 17965559, 18195462, 19571519, 19578646, 19625220, 20423475, 22377704, 23547211, 24447348 View all (7 more)
Arthritis Rheumatoid	Stimulate	27692391
Arthropathy progressive pseudorheumatoid of childhood	Associate	16305696
Asthenia	Associate	33035787
Asthma	Associate	25591454, 34511169, 36592167
Asymptomatic Diseases	Associate	32525932
Atherosclerosis	Associate	19148342, 19403988, 19934557, 20423475, 20433440, 21394321, 26828698, 26915609, 28086795, 29444504, 35680906, 36806868, 36876682
Atrial Fibrillation	Associate	17551576, 28390428
Atrioventricular Septal Defect	Associate	20718043
Atrophy	Associate	31929371, 32758174
Attention Deficit Disorder with Hyperactivity	Associate	21618410, 21897766, 23227261, 34573389, 36655641, 37285328
Autism Spectrum Disorder	Associate	19267885, 22648721, 36655641
Autistic Disorder	Associate	19267885, 33411826
Autoimmune Diseases	Associate	34752683
Azoospermia	Associate	28440964
Beckwith Wiedemann Syndrome	Associate	30165906
Behcet Syndrome	Associate	14521457, 16299146, 22180713, 22773907, 24136464, 31173496
Bell Palsy	Associate	29327764
Beta ketothiolase deficiency	Associate	31173496
beta Thalassemia	Associate	27187171
Bipolar Disorder	Associate	22176285, 22370993, 25101272, 25744938
Birth Weight	Associate	35631247
Bjornstad syndrome	Associate	35631247
Blood Coagulation Disorders	Associate	17442092
Blood Platelet Disorders	Associate	12361206, 15678268, 29115087
Bohring syndrome	Associate	31015243
Bone Diseases Metabolic	Associate	12674333, 22377704, 32549258, 37816983
Brain Diseases	Associate	25264227
Brain Diseases Metabolic Inborn	Associate	17976958
Brain Infarction	Associate	20191019
Brain Ischemia	Associate	29264982
Brain Neoplasms	Associate	32264844
Breast Neoplasms	Associate	12473175, 12602921, 15004488, 15736423, 16097444, 17069650, 17595805, 18669903, 18708404, 18842997, 19123462, 19389261, 19706843, 19707223, 19759169 View all (31 more)
Breast Neoplasms	Inhibit	22373582, 34242313
Breast Neoplasms	Stimulate	29544444
Budd Chiari Syndrome	Associate	12221667, 22180713
Capillary Malformation Arteriovenous Malformation	Associate	37933013
Carcinogenesis	Associate	12060127, 16108833, 20130515, 21180947, 22218157, 23275280, 24966971, 26745044, 27976555, 34242313, 34502300
Carcinoma Basal Cell	Associate	21672255
Carcinoma Hepatocellular	Associate	17503006, 17659576, 19035314, 25318605, 25337902, 31694048, 34502300, 34644732
Carcinoma Non Small Cell Lung	Associate	16334126, 23463763, 24063603, 25104092, 29186089
Carcinoma Renal Cell	Associate	26191297
Carcinoma Squamous Cell	Associate	21342495
Carcinoma Transitional Cell	Associate	23244112
Cardiovascular Diseases	Associate	10027946, 11532106, 15073633, 15735067, 15750260, 15996600, 17622358, 17976958, 18672474, 18840629, 19267198, 21270364, 21613384, 22237773, 22277556 View all (20 more)
Carotid Artery Diseases	Associate	20134102, 32404177, 32675800
Carotid Artery Thrombosis	Associate	11781870, 18160591, 19353312, 29439641
Cataract	Associate	37121723
Cataract Age Related Nuclear	Associate	26689687
Celiac Disease	Associate	19248194, 21688148
Cerebral Arterial Diseases	Associate	31725629
Cerebral Hemorrhage	Associate	25144711, 37898918
Cerebral Infarction	Associate	10572079, 10929044, 11870335, 15946211, 16624841, 16679643, 16936384, 17461517, 18560453, 18672474, 18796459, 19934557, 19934565, 21678004, 22203923 View all (31 more)
Cerebral Infarction	Inhibit	30781868
Cerebral Infarction	Stimulate	36193932
Cerebral Intraventricular Hemorrhage	Associate	23896193, 28578513
Cerebral Palsy	Associate	22098125
Cerebral Small Vessel Diseases	Associate	26839351, 35307828
Cerebrovascular Disorders	Associate	11307798, 3177384
Chemical and Drug Induced Liver Injury	Associate	12453860, 17488658, 33752528
Cholangiocarcinoma	Associate	17201138
Cholelithiasis	Associate	32228104
Choline Deficiency	Associate	27342765
Chorea Gravidarum	Associate	24014470
Choroidal Effusions	Associate	31566926
Choroidal Neovascularization	Associate	30796269
Chromosome Aberrations	Associate	22377705, 27068821, 36008980
Cleft Lip	Associate	18661527, 18797703, 21781437, 28230599, 31663447, 36655641
Cleft Palate	Associate	18661527, 21781437, 27167580, 30578914, 31122291, 31663447, 36901988
Cognition Disorders	Associate	10486408, 19013496, 21358708, 25625218, 25882604, 32325916, 32497019, 34045473, 35307828, 37462970
Cognitive Dysfunction	Associate	25625218, 37462970
Colitis	Associate	18700049
Colitis Ulcerative	Associate	10446107, 31173496, 37816983
Colonic Neoplasms	Associate	11889073, 12107847, 16177213, 21603981
Colorectal Neoplasms	Associate	11781870, 11889073, 12427779, 15161007, 15447919, 15546509, 16103455, 16177213, 16638790, 16819711, 16866026, 16886608, 17036383, 17449906, 17465256 View all (54 more)
Colorectal Neoplasms	Stimulate	18992148, 18996879, 20447924
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	19156174, 37914736
Congenital Abnormalities	Associate	26990189, 28580572, 37933013
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	14527888
Congenital Plasminogen Deficiency	Associate	10629572
Conotruncal cardiac defects	Associate	19493349, 20031554, 20111745, 22495907, 30165839
Constipation	Associate	20551579, 23098510
Constriction Pathologic	Associate	23274712
Corneal Endothelial Cell Loss	Associate	17491230, 26137654
Coronary Artery Disease	Associate	10212171, 10929044, 14521457, 15447919, 16612468, 16802358, 17264399, 17622358, 18403793, 18586656, 18751630, 1998339, 20530057, 20962453, 21769819 View all (15 more)
Coronary Artery Dissection Spontaneous	Associate	11872884
Coronary Disease	Associate	15121769, 16274479, 17591934, 18622257, 23288205, 24218123, 27051002, 29245302, 32675800, 9708460
Coronary Stenosis	Associate	10929044
Coronary Vasospasm	Associate	17000887
Coronavirus Infections	Associate	34061414
COVID 19	Associate	33254541, 34061414, 35415903, 36647888, 36980916
Coxa Magna	Associate	18350352
Craniocerebral Trauma	Associate	18387654, 39769114
Crohn Disease	Associate	10446107, 28002332
Cushing's symphalangism	Associate	23274712, 24846872
Daneman Davy Mancer syndrome	Associate	34644732
Deafness Neural Congenital Moderate	Associate	10929044
Death	Associate	22524826, 22524840, 22605962, 22799365, 25840420, 26277606, 27916838, 32264844, 36102491
Dementia Vascular	Associate	10860300, 11781870
Depressive Disorder	Associate	20096138, 21125200, 21635773, 22739363, 26926881, 27626182, 31185929, 33263678, 33315905, 35904038, 37628752, 39769114
Developmental Disabilities	Associate	20504979, 39769114
dhat syndrome	Associate	39213757
Diabetes Complications	Associate	16274479
Diabetes Gestational	Associate	35334827, 35631247, 37106323, 37818092
Diabetes Gestational	Inhibit	35334827
Diabetes Mellitus	Associate	10090925, 11531629, 15836661, 20134102, 22880024, 23391848, 24218123, 27976555, 29534533
Diabetes Mellitus Insulin Dependent 19	Associate	25700330, 28765644
Diabetes Mellitus Type 1	Associate	11531629
Diabetes Mellitus Type 2	Associate	15836661, 16274479, 19934557, 20134102, 22554825, 24452036, 25165408, 25537992, 27983710, 28231061, 28409162, 29694640, 33455465, 34289004, 35057543
Diabetes Mellitus Type 2	Inhibit	35057543
Diabetic Angiopathies	Associate	16906320, 27990443
Diabetic Foot	Associate	26579581
Diabetic Nephropathies	Associate	22554825, 30729677
Diabetic Neuropathies	Associate	23901246, 24452036
Diabetic Retinopathy	Associate	23901246, 24452036, 32860770
Diarrhea	Associate	19672255, 22045187, 26970343
Disease	Associate	27449989
Dissection Blood Vessel	Associate	11872884, 16844951
Dissection Thoracic Aorta	Associate	35305471
Double Outlet Right Ventricle	Associate	34204335
Down Syndrome	Associate	10930360, 11443546, 15585767, 15834031, 16845273, 18057532, 18257130, 18273817, 19096127, 20592453, 20868477, 21045269, 22377700, 24668664, 26017139, 33440639, 33608632, 35060496 View all (3 more)
Down Syndrome	Stimulate	16845273
Drug Related Side Effects and Adverse Reactions	Associate	11418485, 15361376, 16272757, 17009228, 17213520, 17488658, 19159907, 19384296, 19465420, 20819423, 21887680, 22045187, 23681825, 26142939, 26928923 View all (4 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	21887680
Duane Retraction Syndrome	Associate	34521653
Ductus Arteriosus Patent	Associate	34126931
Dyslipidemias	Associate	26337056, 26442927, 30786773, 34289004, 34498771, 38287840
Ectrodactyly cardiopathy dysmorphism	Associate	36421790
Ectromelia	Associate	21281325
Embolic Stroke	Associate	28963520
Embolism Fat	Associate	32019154
Embryo Loss	Associate	10958762
Encephalitis Herpes Simplex	Associate	25302494
Endometrial Neoplasms	Associate	23299529
Endometriosis	Associate	35788150, 37895084
Epilepsy	Associate	12027572, 17561949, 17904392, 21543238, 22425007, 25915064, 26142939, 27976555, 30442198, 35904038
Epilepsy Idiopathic Generalized	Associate	17904392
Esophageal Neoplasms	Associate	19058336, 21672255, 22292644, 22430803, 22524840, 23803097, 33322951, 36102491
Esophageal Squamous Cell Carcinoma	Associate	16333305, 21375764, 21672255, 22524840, 22853296, 23244153, 24393513, 27323028, 28046029, 33819921
Esophagitis	Associate	25041994, 25337902
Essential Hypertension	Associate	15750260, 16081343, 26442927, 29436860, 32555714, 35284002, 36845669
Exfoliation Syndrome	Associate	16636653, 23687437
Familial antiphospholipid syndrome	Associate	12027572, 23771968
Farber Lipogranulomatosis	Associate	24083702, 27976555, 31066758, 38634541
Fatigue	Associate	23975093, 29186089
Fatty Liver	Associate	21854603, 23547829, 24488901
Fetal Death	Associate	19909951
Fetal Diseases	Associate	11781870, 18160599, 19520681, 24014470
Fetal Growth Retardation	Associate	12097536, 29564022, 40674756
Fetal Growth Retardation	Stimulate	30313110
Fetal Membranes Premature Rupture	Associate	37106323
Fibrosis	Associate	21854603, 23547829, 31929371
Folate Malabsorption Hereditary	Associate	10583261, 12623486, 12958073, 15051606, 18612269, 22277790, 22424391, 22515117, 23936521, 26266420, 26561410, 27187171, 27725412, 28094233, 28963520 View all (7 more)
Folate Malabsorption Hereditary	Inhibit	34502300
Folic Acid Deficiency	Associate	11781870, 14704292, 22901194, 37933013
Folic Acid Deficiency	Inhibit	28045918
Foramen Ovale Patent	Associate	32512924
Fractures Bone	Associate	12674333, 17174622, 17725378
Gangrene	Associate	33462011
Gastritis Atrophic	Associate	19267198, 32758174, 37327296
Gastrointestinal Diseases	Associate	19648163, 25104092
Gastrointestinal Neoplasms	Associate	33322951
Gastroschisis	Associate	26375922
Genetic Diseases Inborn	Associate	10929044, 27321094
Glaucoma	Associate	23687437, 25054348, 27585654
Glaucoma 3 Primary Congenital A	Associate	27585654
Glaucoma Angle Closure	Associate	18385801, 19936026, 27824919
Glaucoma Open Angle	Associate	16636653, 18385801, 19936026, 25054348, 27585654
Glioblastoma	Associate	18497326, 24301776, 32264844
Glioma	Associate	16821630, 18483342, 24301776, 28820331
Glomerulonephritis IGA	Associate	31929371
Glomerulonephritis Membranous	Associate	21500982
Glycogen Storage Disease 0 Muscle	Associate	11279637
Glycosuria Renal	Associate	21613384
Goiter Multinodular 2	Associate	34644732
Graft vs Host Disease	Associate	16920564, 21920473
Hallucinations	Associate	31401974
Hamartoma	Associate	27976555
Hand Foot Syndrome	Associate	23736036, 31601265
Head and Neck Neoplasms	Associate	22430803, 23276522
Headache	Associate	30170616
Hearing Loss	Associate	21385350, 22424391
Hearing Loss Functional	Associate	34847989
Hearing Loss Sensorineural	Associate	22424391
Heart Defects Congenital	Associate	15951337, 16305696, 20031554, 21254360, 22197386, 25494855, 25846410, 26035828, 26990189, 28230599, 28758112, 29793361, 33219830, 33440639, 34126931, 36421790, 36655641, 38287462 View all (3 more)
Heart Diseases	Associate	26654251, 35499926, 36845669, 37898918, 40562371
Heart Septal Defects	Associate	32512924, 38287462
Heart Septal Defects Atrial	Associate	19764075, 34126931, 36421790
Heart Septal Defects Ventricular	Associate	20031554, 28758112, 34126931, 35870951, 36421790, 36759823
Heart Valve Diseases	Associate	26813460
Helicobacter Infections	Associate	23183616, 24615072, 38579505
Hematologic Diseases	Associate	19159907, 19764075, 25041994, 36794870, 37633908
Hemoglobin SC Disease	Associate	16906320
Hemolytic Uremic Syndrome	Associate	19448163
Hemorrhage	Associate	19959486, 22098125, 30819996
Hemorrhagic Stroke	Associate	22203923
Hemorrhoids	Associate	30830849
Hepatitis C	Associate	34644732
Hepatitis C Chronic	Associate	21854603
Hereditary Breast and Ovarian Cancer Syndrome	Associate	17595805, 22669161, 27237471
Hereditary Sensory and Autonomic Neuropathies	Associate	30273369
Hirschsprung Disease	Associate	26314858
Hodgkin Disease	Associate	16538645
Homocysteinemia	Associate	16011963, 16679643, 17449548, 17561949, 18796459, 19125845, 19846961, 22628232, 23869894, 24506394, 25380613, 3177384, 33254541, 9350916
Homocystinuria	Associate	23866722, 32347013, 33057012, 39322052, 7726158, 9490685
Huntington Disease	Associate	16372906, 36902304
Hydrocephalus	Associate	16184507
Hyperalgesia	Associate	23975093
Hyperbilirubinemia Neonatal	Associate	23936521
Hypercholesterolemia	Associate	26442927
Hyperglycemia	Associate	29264982
Hyperhomocysteinemia	Associate	10323785, 10958762, 11169021, 11279637, 11531629, 11781870, 12221667, 14603192, 14717963, 15051606, 15114606, 15226189, 15497528, 15612980, 15750260 View all (88 more)
Hyperhomocysteinemia	Inhibit	17976958, 29428336
Hyperlipidemias	Associate	11870335, 23865383
Hyperlipoproteinemia Type II	Associate	20065615
Hyperparathyroidism	Associate	23534584
Hyperplasia	Associate	36845669
Hypertension	Associate	12797595, 18654952, 18855261, 19013496, 19330901, 20592457, 21270364, 22237773, 22277556, 22676332, 22897803, 23188888, 24189452, 24459043, 24959828 View all (35 more)
Hypertension Pregnancy Induced	Stimulate	32720760
Hypertension Pregnancy Induced	Associate	32720760, 37106323, 40674756
Hypertensive Retinopathy	Associate	16274479, 16906320, 23901246
Hyperthyroidism	Associate	31066758
Hypertriglyceridemia	Associate	26337056, 30786773
Hypertrophy	Associate	36845669
Hypertrophy Left Ventricular	Associate	23534584
Hyperuricemia	Associate	15082892, 32278343, 38287840
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	16299146
Hypospadias	Associate	40674756
Hypotension Orthostatic	Associate	22504314
Hypothyroidism	Associate	31066758
Hypoxia Brain	Associate	22117975
IgA Vasculitis	Associate	15361376
Ige Responsiveness Atopic	Associate	36592167
Iliac Aneurysm	Associate	33462011
Immunologic Deficiency Syndromes	Associate	12436152, 23936521
Infant Newborn Diseases	Associate	23162020, 25829992
Infarction	Associate	23975911
Infarction Anterior Cerebral Artery	Associate	40562371
Infections	Associate	38579505
Inferior Wall Myocardial Infarction	Associate	36876682
Infertility	Associate	18930220, 19324355, 19657388, 24737513, 25283235, 31173496, 32399796, 33914208, 36008980
Infertility Female	Associate	19324355
Infertility Male	Associate	21085488, 21857689, 22457816, 22692281, 24737513, 27232852, 28270024, 28842818, 33786731, 36655641
Inflammation	Associate	19332210, 29396861, 32019154, 34752683
Inflammatory Bowel Diseases	Associate	10446107, 16249980, 16262529, 28002332, 37816983
Insulin Resistance	Associate	17976958, 24488901, 29658358, 31200713
Intestinal Diseases	Associate	32758174, 37327296
Intracranial Aneurysm	Associate	23460600
Intracranial Arteriosclerosis	Associate	36197177
Intracranial Thrombosis	Associate	17456624, 21500982, 29168367, 31025572, 37076800
Ischemic Attack Transient	Associate	11307798, 32347013, 34241942
Ischemic Stroke	Associate	31725629, 37204128
Job Syndrome	Associate	10446107, 17561949, 18855261
Joint Diseases	Associate	31566926
Kidney Diseases	Associate	11532106, 16274479, 16760910, 21613384, 22897803, 26717388, 38238653
Kidney Failure Chronic	Associate	11532106, 16557227, 19520684, 24785111, 9264011
Kidney Neoplasms	Associate	21613384
Klinefelter Syndrome	Associate	18160591
Laryngeal Neoplasms	Associate	23838799
Laryngitis	Associate	26535623
Learning Disabilities	Associate	39769114
Legg Calve Perthes Disease	Associate	35264229
Leukemia	Associate	10029588, 11274424, 12453860, 12958073, 18339682, 20101025, 21873357, 22377705, 25793509, 26438060, 33930029
Leukemia Eosinophilic Acute	Associate	29916259
Leukemia Lymphocytic Chronic B Cell	Associate	11781870
Leukemia Lymphoma Adult T Cell	Associate	26438060
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	24966971, 25510667
Leukemia Myeloid Acute	Associate	10536004, 11274424, 20101025, 26438060, 28374953
Leukemia Promyelocytic Acute	Associate	9054653
Leukoaraiosis	Associate	27583843
Leukoencephalopathies	Associate	18806228, 25829992, 30362058, 33148145, 33833133, 37527941
Leukopenia	Associate	19648163, 26970343, 29186089
Livedoid Vasculopathy	Associate	17442092, 23901246
Liver Cirrhosis Biliary	Associate	16570355
Liver Diseases	Associate	17503006, 26137554
Liver Failure Acute	Associate	27783703
Liver Neoplasms	Associate	21128869
Lung Diseases	Associate	22052259
Lung Neoplasms	Associate	16334126, 20065319, 21342495, 22024018, 22144047, 22938410, 23372658, 24175756, 25536611, 25921104, 28236470, 34325549
Lupus Erythematosus Systemic	Associate	12027572, 15934123, 16802358, 19625220, 31173496, 35507987
Lyme Disease	Associate	26862099
Lymphatic Metastasis	Associate	23244112, 31523170
Lymphoma	Associate	11342450, 14535593, 15551285, 15921520, 16886608, 21504712, 23174714, 37527941
Lymphoma	Inhibit	15551285
Lymphoma B Cell Marginal Zone	Associate	28779180
Lymphoma Follicular	Associate	15198953, 16410450
Lymphoma Large B Cell Diffuse	Associate	14535593, 15198953, 18288132, 21504712, 23174714
Lymphoma Non Hodgkin	Associate	15198953, 17119116, 17488658, 23174714, 28779180
Lymphoma Non Hodgkin	Inhibit	17119116, 18042267
Lymphoproliferative Disorders	Associate	16538645
Macular Degeneration	Associate	30796269
Malaria	Associate	27198213
Meningioma	Associate	16821630, 18483342, 30583664, 34169999
Meningioma	Inhibit	30583664
Meningomyelocele	Associate	18937358, 23227261, 27384413
Mental Disorders	Associate	30633186, 31401974, 36014826, 36655641
Mesenteric Ischemia	Associate	19846322
Mesenteric Vascular Occlusion	Associate	11133719, 36655641
Metabolic Diseases	Associate	18523009, 19225123, 25318605
Metabolic Syndrome	Associate	17491230, 17976958, 19267885, 20724652, 22370993, 22690662, 22832733, 25429430, 25432492, 27321094, 29658358, 34371949, 36806868
Metabolism Inborn Errors	Associate	36655641, 9490685
Methylcobalamin Deficiency CblG Type	Associate	18842997
Methylenetetrahydrofolate reductase deficiency	Inhibit	10551815
Methylenetetrahydrofolate reductase deficiency	Associate	1998340, 33290257, 36655641, 38238653, 7726158, 8940272
Methylmalonic Aciduria and Homocystinuria CblF Type	Associate	8903338
Microsatellite Instability	Associate	20193847
Microvascular Angina	Associate	17491230
Migraine Disorders	Associate	15053827, 18672474, 19384265, 19673907, 21635773, 23430981, 23915182, 23975093, 27976555, 30170616
Migraine with Aura	Associate	15053827, 18672474, 19673907, 21635773, 23230240, 23430981, 23915182, 30170616
Migraine with Aura	Inhibit	19673907
Migraine without Aura	Associate	23915182
Mitral Valve Insufficiency	Associate	26813460
Mouth Diseases	Associate	21920473
Mouth Neoplasms	Associate	16080493, 26749456
Mucositis	Associate	17488658, 22045187, 34614057
Multiple Sclerosis	Associate	19854238, 24412677, 25625218, 31038186, 32355262
Multiple Sclerosis Relapsing Remitting	Associate	24412677
Muscular Disorders Atrophic	Associate	37327296
Myasthenia Gravis	Associate	27999265
Mycobacterium Infections	Associate	27686649
Mycobacterium Infections Nontuberculous	Associate	27686649
Myelodysplastic Syndromes	Associate	27449989
Myocardial Infarction	Associate	10090925, 11303694, 12615788, 14717963, 22750768, 23171482, 23274712, 36279151, 36876682
Myocardial Ischemia	Associate	24452036
Myotonic Dystrophy	Associate	29534533
Nausea	Associate	29186089
Necrosis	Associate	34169999
Neoplasm Metastasis	Associate	17925917, 26046315
Neoplasms	Associate	11274424, 12107847, 14716779, 15161007, 16177213, 16272757, 16532039, 16538645, 16821630, 16985020, 17036383, 17069650, 17488658, 17533396, 17591934 View all (54 more)
Neoplasms	Inhibit	12060127, 34502300
Neoplasms	Stimulate	23803051, 27916838
Neoplasms Adipose Tissue	Associate	17976958
Neoplasms Squamous Cell	Associate	21672255, 28353639
Neoplastic Syndromes Hereditary	Associate	21500982, 30633186
Nephrosclerosis	Associate	21613384
Nerve Compression Syndromes	Associate	23975093
Neural Tube Defects	Associate	10090889, 10551815, 10958762, 11274424, 11781870, 12384833, 12594357, 15060097, 15921520, 17035141, 19178434, 19803295, 20031554, 20589617, 22903727 View all (18 more)
Neuroblastoma	Associate	32295184
Neurocognitive Disorders	Associate	21618410
Neurodegenerative Diseases	Associate	19421414, 25054348, 27380243, 27585654
Neurofibroma	Associate	27976555
Neurofibromatoses	Associate	27976555
Neurofibromatosis 1	Associate	27976555
Neurologic Manifestations	Associate	23749819, 39769114, 7726158
Neurotoxicity Syndromes	Associate	19031955, 21064136
Neutropenia	Associate	28747156, 29186089
Non alcoholic Fatty Liver Disease	Associate	23547829, 24488901, 26031974, 28507283
Nonsyndromic Deafness	Associate	22424391
Obesity	Associate	20664391, 25432492, 25612568, 25846410, 27322299, 27793164, 27983710, 29694640, 31671528, 32019154, 33455465, 37106323
Obesity Abdominal	Associate	29658358
Oguchi disease	Associate	22665972
Oligodendroglioma	Associate	24301776
Oligospermia	Associate	21085488, 22457816, 28440964, 31127676
Opioid Related Disorders	Associate	35328943
Optic Nerve Diseases	Associate	23771968
Optic Nerve Glioma	Associate	27976555
Optic Neuropathy Ischemic	Associate	18796459, 23401650
Oral Ulcer	Associate	16299146
Orofacial Cleft 1	Associate	21254359, 27167580, 38219184
Osteoarthritis	Associate	23089924
Osteonecrosis	Associate	18350352, 20229089, 9840906
Osteoporosis	Associate	17174622, 22377704, 24014470, 29534533, 39310265
Osteoporotic Fractures	Associate	17174622, 17725378, 29534533
Osteosarcoma	Associate	19159907, 27837635
Ovarian Diseases	Associate	30922641
Ovarian Hyperstimulation Syndrome	Associate	16009185, 30922641
Ovarian Neoplasms	Associate	16011963, 20817226, 22524826, 22605962, 37628752, 9099956
Overweight	Associate	27322299, 27793164, 27983710, 29925788, 31671528, 32019154, 37106323
Pancreatic Neoplasms	Associate	24895587, 27473058, 29474406
Pancreatitis	Associate	23468971
Papillomavirus Infections	Associate	24474455
Paraparesis	Associate	30544400
Parkinson Disease	Associate	17691219, 25909872, 27613114
Paroxysmal ventricular fibrillation	Associate	27759448
Pediatric Obesity	Associate	22098125
Peripheral Arterial Disease	Associate	16274479, 32633259, 7647779
Peripheral Nervous System Diseases	Associate	23468971, 23901246, 28231061, 37522679
Peripheral Vascular Diseases	Associate	21394321
Phenylketonurias	Associate	29465562
Phlebitis	Associate	17000887
Photophobia	Associate	23915182
Polycystic Ovary Syndrome	Associate	17454207, 27321094, 28081274, 31482954, 33407572
Polyostotic osteolytic dysplasia hereditary expansile	Associate	26314858
Post Acute COVID 19 Syndrome	Associate	37112866
Postoperative Nausea and Vomiting	Associate	26970343
Pre Eclampsia	Associate	15059157, 24611473, 26214484, 27755385, 29564022, 32720760, 9192280
Pre Eclampsia	Inhibit	27755385
Precancerous Conditions	Associate	21672255, 32758174
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10029588, 10536004, 11274424, 11986237, 12958073, 16886608, 17970089, 20002681, 20071789, 21873357, 24476575, 26438060, 27409003, 29390492, 31443485, 31499477, 31737664 View all (2 more)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	11986237, 20002681
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11736945, 24476575, 36655641
Preeclamptic toxemia	Associate	10877984, 15059157
Premature Birth	Associate	11531629, 23936521, 29428336, 32720760, 34907829, 35631247, 35691911
Premature Birth	Inhibit	32720760
Pressure Ulcer	Associate	22606049
Proctitis	Associate	18700049
Propping Zerres syndrome	Associate	17970089
Prostatic Neoplasms	Associate	22296369, 23275280, 26107198, 27819322, 27916838
Prostatitis	Associate	27916838
Protein C Deficiency	Associate	10029588
Protein S Deficiency	Associate	32347013
Pseudotumor Cerebri	Associate	36607854
Psoriasis	Associate	30999684
Psychotic Disorders	Associate	31401974, 39769114
Pulmonary Arterial Hypertension	Associate	12797595, 29027816
Pulmonary Atresia	Associate	16305696
Pulmonary Embolism	Associate	16432849, 18586684, 18800213, 19520679, 26987498, 27729560, 29916259, 33128086, 40453635
Pulmonary Valve Stenosis	Associate	16305696
Pyoderma Gangrenosum	Associate	31015243
Pyruvate Carboxylase Deficiency Disease	Associate	16432849
Radiation Pneumonitis	Associate	22144047, 28046029
Raynaud Disease	Associate	31651110
Rectal Neoplasms	Associate	17245555, 20056627, 20920350, 21462086, 21603981, 21865946, 22045187, 22218157, 23098510, 25041994
Renal Artery Obstruction	Associate	23146986
Renal cell carcinoma 1	Inhibit	3177384
Renal Insufficiency	Associate	20433440, 23534584, 26247037, 29785531, 37005654, 37239884
Renal Insufficiency Chronic	Associate	18405246, 22897803, 26579581
Respiratory Tract Diseases	Associate	33035787
Retinal Artery Occlusion	Associate	26862099
Retinal Diseases	Associate	16015408
Retinal Vein Occlusion	Associate	11122096, 11673296, 14527888, 19825913, 19825918, 24569626, 27221722, 31173043, 31831825, 32347013, 33370962
Retinopathy of Prematurity	Associate	37511576
Rheumatic Heart Disease	Associate	26813460
Riboflavin Deficiency	Associate	14704292, 36264281
Rumination Syndrome	Associate	26926881
Schizophrenia	Associate	17976958, 22370993, 25101272, 27932499, 31401974, 32347013, 32497019, 39769114
Scleroderma Systemic	Associate	37239884
Seizures	Associate	12027572, 30442198, 35904038, 37491869
Sensation Disorders	Associate	39769114
Septate Uterus	Associate	32512924, 36421790
Sinus Thrombosis Intracranial	Associate	19703820, 23172871, 24923843
Sjogren's Syndrome	Associate	28779180, 31173496
Skin Diseases	Associate	29421402
Sleep Initiation and Maintenance Disorders	Associate	23975093, 34847989
Slowed Nerve Conduction Velocity Autosomal Dominant	Associate	37260067
Small Cell Lung Carcinoma	Associate	17533396
Smoke Inhalation Injury	Associate	22024018
Soft Tissue Injuries	Associate	36232908
Spina Bifida Occulta	Associate	20066615
Spinal Cord Diseases	Associate	16361298
Spinal Dysraphism	Associate	12180146, 17479212, 18937353, 19683694, 21204206, 24323870, 7564788, 9327028, 9863598
Squamous Cell Carcinoma of Head and Neck	Associate	17596206, 21180947, 21460376, 26535623, 26749456, 32079256
Stomach Neoplasms	Associate	15244514, 16158971, 16886608, 17201138, 18231104, 20237899, 20504332, 23183616, 23534741, 23803092, 23934457, 24490800, 24615072, 24737431, 25337902 View all (6 more)
Stomatitis	Associate	25041994, 27452984
Stroke	Associate	11307798, 14693836, 15497528, 16624841, 16782775, 16906320, 16936384, 17098841, 18560453, 21394321, 21678004, 22275392, 22594584, 23285280, 23547211 View all (15 more)
Stroke Lacunar	Associate	26839351
Subarachnoid Hemorrhage	Associate	19826759
Tertiary Lymphoid Structures	Associate	26749456, 33639682
Thalamic Diseases	Associate	15497528
Thrombasthenia	Associate	30819996
Thromboangiitis Obliterans	Associate	17000887
Thrombocytopenia	Associate	17488658, 25104092
Thromboembolism	Associate	10446107, 12469051, 16188774, 16379339, 17911197, 19715531, 23866722, 32347013, 9490685
Thrombophilia	Associate	11426488, 11821094, 12555209, 15497023, 15678268, 15748240, 15821810, 15834246, 16015408, 16184507, 17456620, 18160589, 18160591, 18191809, 19520681 View all (31 more)
Thrombophilia hereditary	Associate	18840629, 19520681, 22750768, 24235948, 31173496, 36980916
Thrombosis	Associate	10029588, 10440914, 10929044, 11122096, 11426488, 12361206, 15114606, 15834246, 16080493, 16173969, 16679643, 17000887, 17456626, 17911197, 18796459 View all (28 more)
Thrombotic Microangiopathies	Associate	19448163
Thrombotic Stroke	Associate	23162020, 40691374
Thymoma	Associate	27999265
Thyroid Diseases	Associate	15447919, 31066758
Thyroid Neoplasms	Associate	29511243
Tooth Loss	Associate	17895510
Trichothiodystrophy Syndromes	Associate	28842818
Triple Negative Breast Neoplasms	Associate	25801246, 32497019, 34242313
Trisomy 18 Syndrome	Associate	11443546
Turner Syndrome	Associate	22283972, 26217949
Ulcer	Associate	17000887
Uremia	Associate	9264011
Urethral Neoplasms	Associate	29472622
Urinary Bladder Neoplasms	Associate	22126575, 22747749, 28348449, 32340630, 40570095
Urolithiasis	Associate	32228104
Uterine Cervical Diseases	Associate	23444906
Uterine Cervical Dysplasia	Associate	17303386, 20130515, 21897271, 24474455, 25302494
Uterine Cervical Neoplasms	Associate	24474455, 29740106, 31750632
Uterine Cervicitis	Associate	23444906
Varicose Ulcer	Associate	21500982
Varicose Veins	Associate	26137554
Vascular Calcification	Associate	21394321
Vascular Diseases	Associate	10323785, 10551815, 11169021, 11274424, 11279637, 11531629, 15053827, 15921520, 17449548, 18855261, 22594584, 23285280, 26137654, 26915609, 30557982 View all (5 more)
Vascular Malformations	Associate	31725629
Vasospasm Intracranial	Associate	17000887
Venous Insufficiency	Associate	26137554
Venous Thromboembolism	Associate	10029588, 15009459, 15886665, 19520679, 20229089, 21078611, 22628232, 23288205, 23866722, 26915609, 27686649, 29916259, 34325549, 40453635, 9217179, 9792287 View all (1 more)
Venous Thrombosis	Associate	10360908, 10929044, 11122096, 11781870, 15096570, 15114595, 16188774, 16379339, 16634748, 17442092, 17591934, 18293456, 18800213, 19353312, 22707612 View all (18 more)
Venous Thrombosis	Stimulate	26261166
Virus Diseases	Associate	23444906
Vitamin A Deficiency	Associate	31401974
Vitamin B 12 Deficiency	Associate	16445837, 16988141, 17449548, 17908667, 19094231, 22470444, 26137654, 28094233, 37101129
Vitiligo	Associate	30720153
von Willebrand Diseases	Associate	19959486
Weight Gain	Associate	27932499
Wounds and Injuries	Associate	23749819
Xanthomatosis Cerebrotendinous	Associate	15612980

MTHFR (methylenetetrahydrofolate reductase)