Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4524
Gene name	Methylenetetrahydrofolate reductase
Gene symbol	MTHFR
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p36.22
Summary	The protein encoded by this gene catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine. Genetic variation in this gene influences susceptibility to occlusive vas

Show/Hide all (81)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1801131	T>G	Benign, benign-likely-benign, other, risk-factor, uncertain-significance	Non coding transcript variant, coding sequence variant, missense variant
rs1801133	G>A,C	Likely-benign, not-provided, conflicting-interpretations-of-pathogenicity, drug-response, other, uncertain-significance	Non coding transcript variant, coding sequence variant, missense variant
rs2066464	T>C	Conflicting-interpretations-of-pathogenicity	Intron variant, non coding transcript variant
rs34279942	G>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, missense variant, non coding transcript variant
rs45449298	C>A,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, non coding transcript variant
rs45590836	C>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs79157191	G>A,T	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, synonymous variant, coding sequence variant
rs115049252	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, intron variant, coding sequence variant
rs121434294	G>A	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs121434295	C>T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs121434296	G>A	Likely-pathogenic, pathogenic, uncertain-significance	Non coding transcript variant, missense variant, coding sequence variant
rs121434297	A>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs138189536	G>A	Pathogenic, likely-benign	5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant
rs139645527	C>A,G	Conflicting-interpretations-of-pathogenicity, pathogenic	Stop gained, non coding transcript variant, missense variant, coding sequence variant
rs140277700	G>A	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs142612062	T>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, missense variant
rs142617551	T>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, non coding transcript variant, missense variant
rs144921426	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, non coding transcript variant
rs147257424	C>A,G,T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs150847674	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant
rs200100285	T>C,G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs200137991	C>A,G,T	Pathogenic	Missense variant, stop gained, coding sequence variant, non coding transcript variant
rs267606886	A>C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs267606887	T>C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs367585605	C>A,T	Pathogenic, uncertain-significance	Non coding transcript variant, coding sequence variant, synonymous variant
rs368321176	A>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs373398993	A>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs377443637	G>A	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs543016186	C>G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs574132670	C>T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs746353274	TTC>-	Pathogenic	Coding sequence variant, inframe deletion, non coding transcript variant
rs747846362	C>A	Pathogenic	Splice donor variant
rs748571395	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs749765738	A>C,G	Pathogenic	Splice donor variant
rs750323424	C>T	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs754980119	C>G,T	Pathogenic	5 prime UTR variant, coding sequence variant, non coding transcript variant, missense variant
rs758206023	G>A,C	Pathogenic	Intron variant, coding sequence variant, missense variant
rs759031330	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs763539350	G>A,C	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant, 5 prime UTR variant, missense variant
rs765586205	C>T	Pathogenic	Non coding transcript variant, synonymous variant, coding sequence variant
rs769381688	G>A	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs769953411	C>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs776483190	C>G,T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant, 5 prime UTR variant
rs776734688	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant, 5 prime UTR variant, initiator codon variant
rs776969786	G>A,C	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant, 5 prime UTR variant, stop gained
rs777661576	C>T	Pathogenic	Intron variant
rs780014899	T>-	Pathogenic	Splice acceptor variant
rs786204007	C>G,T	Pathogenic	Missense variant, coding sequence variant, stop gained, 5 prime UTR variant, non coding transcript variant
rs786204009	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant, 5 prime UTR variant
rs786204010	->TCACCTGCTGGGTGCCAGGTCACGTCTATGTAGAGGGGG	Pathogenic	Inframe insertion, coding sequence variant, non coding transcript variant
rs786204012	A>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204013	T>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204014	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204016	TGA>-	Pathogenic	Coding sequence variant, inframe deletion, non coding transcript variant
rs786204017	G>A,C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204018	C>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204019	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204020	C>A,T	Pathogenic	Splice donor variant
rs786204021	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204022	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204023	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204024	T>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204026	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204027	A>C,G	Pathogenic	Splice donor variant
rs786204028	C>A,T	Pathogenic, not-provided	Missense variant, coding sequence variant, non coding transcript variant
rs786204030	C>T	Pathogenic, risk-factor	Coding sequence variant, stop gained, non coding transcript variant
rs786204031	A>C,G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786204034	A>G	Pathogenic	Missense variant, coding sequence variant, intron variant
rs786204035	CA>AC	Pathogenic	Coding sequence variant, intron variant, stop gained, inframe indel
rs786204037	A>G,T	Pathogenic	Missense variant, coding sequence variant, intron variant
rs986604359	G>A	Pathogenic	Stop gained, coding sequence variant, 5 prime UTR variant, non coding transcript variant
rs1057519359	C>T	Pathogenic	Splice donor variant
rs1057519360	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1057519361	G>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1057519362	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1057519363	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1553185069	A>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1553185497	C>T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1553187509	C>A	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant, 5 prime UTR variant
rs1553188112	AG>-	Pathogenic	Intron variant
rs1557761665	->C	Likely-pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant

820

Show/Hide all (820)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027114	hsa-miR-103a-3p	Sequencing	20371350
MIRT031648	hsa-miR-16-5p	Sequencing	20371350
MIRT042604	hsa-miR-423-3p	CLASH	23622248
MIRT618790	hsa-miR-1972	HITS-CLIP	23824327
MIRT618789	hsa-miR-4480	HITS-CLIP	23824327
MIRT618788	hsa-miR-3978	HITS-CLIP	23824327
MIRT550618	hsa-miR-4318	PAR-CLIP	21572407
MIRT550619	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT550617	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031648	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT550616	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT550615	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT550614	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT550613	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT550611	hsa-miR-4476	PAR-CLIP	21572407
MIRT550612	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT550610	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT550609	hsa-miR-6814-5p	PAR-CLIP	21572407
MIRT550608	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT550607	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT550606	hsa-miR-7154-3p	PAR-CLIP	21572407
MIRT550605	hsa-miR-765	PAR-CLIP	21572407
MIRT550604	hsa-miR-6894-5p	PAR-CLIP	21572407
MIRT550603	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT472857	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT472855	hsa-miR-764	PAR-CLIP	23592263
MIRT472854	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT472853	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT472852	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT472851	hsa-miR-5698	PAR-CLIP	23592263
MIRT472850	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT472848	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT472849	hsa-miR-4525	PAR-CLIP	23592263
MIRT472847	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT472846	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT472845	hsa-miR-4447	PAR-CLIP	23592263
MIRT472844	hsa-miR-4472	PAR-CLIP	23592263
MIRT472843	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT734975	hsa-miR-22-3p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	28045918
MIRT731665	hsa-miR-149-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	28045918
MIRT731665	hsa-miR-149-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	28045918
MIRT734975	hsa-miR-22-3p	Luciferase reporter assayImmunoprecipitaion (IP)ImmunofluorescenceFlow cytometry	33168819
MIRT618790	hsa-miR-1972	HITS-CLIP	23824327
MIRT618789	hsa-miR-4480	HITS-CLIP	23824327
MIRT618788	hsa-miR-3978	HITS-CLIP	23824327
MIRT550618	hsa-miR-4318	PAR-CLIP	21572407
MIRT550619	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT550617	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031648	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT550616	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT550615	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT550614	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT550613	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT550611	hsa-miR-4476	PAR-CLIP	21572407
MIRT550612	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT550610	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT550609	hsa-miR-6814-5p	PAR-CLIP	21572407
MIRT550608	hsa-miR-7114-5p	PAR-CLIP	21572407
MIRT550607	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT550606	hsa-miR-7154-3p	PAR-CLIP	21572407
MIRT550605	hsa-miR-765	PAR-CLIP	21572407
MIRT550604	hsa-miR-6894-5p	PAR-CLIP	21572407
MIRT550603	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT472857	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT472855	hsa-miR-764	PAR-CLIP	23592263
MIRT472854	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT472853	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT472852	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT472851	hsa-miR-5698	PAR-CLIP	23592263
MIRT472850	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT472848	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT472849	hsa-miR-4525	PAR-CLIP	23592263
MIRT472847	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT472846	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT472845	hsa-miR-4447	PAR-CLIP	23592263
MIRT472844	hsa-miR-4472	PAR-CLIP	23592263
MIRT472843	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT734975	hsa-miR-22-3p	Luciferase reporter assayWestern blotting	37799388
MIRT1163290	hsa-miR-103a	CLIP-seq
MIRT1163291	hsa-miR-103b	CLIP-seq
MIRT1163292	hsa-miR-107	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163294	hsa-miR-1197	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT1163296	hsa-miR-1202	CLIP-seq
MIRT1163297	hsa-miR-1207-3p	CLIP-seq
MIRT1163298	hsa-miR-1224-3p	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT1163300	hsa-miR-1245	CLIP-seq
MIRT1163301	hsa-miR-1245b-3p	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT1163303	hsa-miR-1260	CLIP-seq
MIRT1163304	hsa-miR-1260b	CLIP-seq
MIRT1163305	hsa-miR-1266	CLIP-seq
MIRT1163306	hsa-miR-1275	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT1163308	hsa-miR-1280	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT1163310	hsa-miR-1292	CLIP-seq
MIRT1163311	hsa-miR-129-3p	CLIP-seq
MIRT1163312	hsa-miR-1297	CLIP-seq
MIRT1163313	hsa-miR-182	CLIP-seq
MIRT1163314	hsa-miR-185	CLIP-seq
MIRT1163315	hsa-miR-18a	CLIP-seq
MIRT1163316	hsa-miR-18b	CLIP-seq
MIRT1163317	hsa-miR-1909	CLIP-seq
MIRT1163318	hsa-miR-200b	CLIP-seq
MIRT1163319	hsa-miR-200c	CLIP-seq
MIRT1163320	hsa-miR-26a	CLIP-seq
MIRT1163321	hsa-miR-26b	CLIP-seq
MIRT1163322	hsa-miR-2861	CLIP-seq
MIRT1163323	hsa-miR-296-5p	CLIP-seq
MIRT1163324	hsa-miR-3140-5p	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT1163326	hsa-miR-3148	CLIP-seq
MIRT1163327	hsa-miR-3158-3p	CLIP-seq
MIRT1163328	hsa-miR-3170	CLIP-seq
MIRT1163329	hsa-miR-3175	CLIP-seq
MIRT1163330	hsa-miR-3176	CLIP-seq
MIRT1163331	hsa-miR-3180-5p	CLIP-seq
MIRT1163332	hsa-miR-3183	CLIP-seq
MIRT1163333	hsa-miR-3184	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT1163335	hsa-miR-3194-3p	CLIP-seq
MIRT1163336	hsa-miR-3198	CLIP-seq
MIRT1163337	hsa-miR-320e	CLIP-seq
MIRT1163338	hsa-miR-326	CLIP-seq
MIRT1163339	hsa-miR-330-5p	CLIP-seq
MIRT1163340	hsa-miR-339-3p	CLIP-seq
MIRT1163341	hsa-miR-3609	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT1163343	hsa-miR-3651	CLIP-seq
MIRT1163344	hsa-miR-3663-5p	CLIP-seq
MIRT1163345	hsa-miR-3664-3p	CLIP-seq
MIRT1163346	hsa-miR-3689d	CLIP-seq
MIRT1163347	hsa-miR-3922-3p	CLIP-seq
MIRT1163348	hsa-miR-3934	CLIP-seq
MIRT1163349	hsa-miR-3944-5p	CLIP-seq
MIRT1163350	hsa-miR-3972	CLIP-seq
MIRT1163351	hsa-miR-423-5p	CLIP-seq
MIRT1163352	hsa-miR-425	CLIP-seq
MIRT1163353	hsa-miR-4259	CLIP-seq
MIRT1163354	hsa-miR-4274	CLIP-seq
MIRT1163355	hsa-miR-4279	CLIP-seq
MIRT1163356	hsa-miR-429	CLIP-seq
MIRT1163357	hsa-miR-4294	CLIP-seq
MIRT1163358	hsa-miR-4299	CLIP-seq
MIRT1163359	hsa-miR-4306	CLIP-seq
MIRT1163360	hsa-miR-4309	CLIP-seq
MIRT1163361	hsa-miR-4313	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT1163364	hsa-miR-4330	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT1163366	hsa-miR-4423-5p	CLIP-seq
MIRT1163367	hsa-miR-4433	CLIP-seq
MIRT1163368	hsa-miR-4435	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT1163370	hsa-miR-4446-3p	CLIP-seq
MIRT1163371	hsa-miR-4456	CLIP-seq
MIRT1163372	hsa-miR-4459	CLIP-seq
MIRT1163373	hsa-miR-4465	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT1163375	hsa-miR-4469	CLIP-seq
MIRT1163376	hsa-miR-4485	CLIP-seq
MIRT1163377	hsa-miR-4488	CLIP-seq
MIRT1163378	hsa-miR-4494	CLIP-seq
MIRT1163379	hsa-miR-4512	CLIP-seq
MIRT1163380	hsa-miR-4518	CLIP-seq
MIRT1163381	hsa-miR-4519	CLIP-seq
MIRT1163382	hsa-miR-4522	CLIP-seq
MIRT1163383	hsa-miR-4532	CLIP-seq
MIRT1163384	hsa-miR-4539	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT1163387	hsa-miR-4640-3p	CLIP-seq
MIRT1163388	hsa-miR-4641	CLIP-seq
MIRT1163389	hsa-miR-4644	CLIP-seq
MIRT1163390	hsa-miR-4650-5p	CLIP-seq
MIRT1163391	hsa-miR-4651	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT1163393	hsa-miR-4656	CLIP-seq
MIRT1163394	hsa-miR-4659a-5p	CLIP-seq
MIRT1163395	hsa-miR-4659b-5p	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT1163397	hsa-miR-4680-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT1163399	hsa-miR-4687-5p	CLIP-seq
MIRT1163400	hsa-miR-4695-3p	CLIP-seq
MIRT1163401	hsa-miR-4697-5p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT1163403	hsa-miR-4704-5p	CLIP-seq
MIRT1163404	hsa-miR-4711-5p	CLIP-seq
MIRT1163405	hsa-miR-4714-3p	CLIP-seq
MIRT1163406	hsa-miR-4715-3p	CLIP-seq
MIRT1163407	hsa-miR-4715-5p	CLIP-seq
MIRT1163408	hsa-miR-4723-3p	CLIP-seq
MIRT1163409	hsa-miR-4727-5p	CLIP-seq
MIRT1163410	hsa-miR-4735-3p	CLIP-seq
MIRT1163411	hsa-miR-4755-3p	CLIP-seq
MIRT1163412	hsa-miR-4768-3p	CLIP-seq
MIRT1163413	hsa-miR-4769-3p	CLIP-seq
MIRT1163414	hsa-miR-4772-3p	CLIP-seq
MIRT1163415	hsa-miR-4776-3p	CLIP-seq
MIRT1163416	hsa-miR-4781-3p	CLIP-seq
MIRT1163417	hsa-miR-4786-3p	CLIP-seq
MIRT1163418	hsa-miR-4787-5p	CLIP-seq
MIRT1163419	hsa-miR-4802-5p	CLIP-seq
MIRT1163420	hsa-miR-486-3p	CLIP-seq
MIRT1163421	hsa-miR-499a-5p	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT1163425	hsa-miR-532-3p	CLIP-seq
MIRT1163426	hsa-miR-543	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT1163428	hsa-miR-548ah	CLIP-seq
MIRT1163429	hsa-miR-548q	CLIP-seq
MIRT1163430	hsa-miR-548t	CLIP-seq
MIRT1163431	hsa-miR-548v	CLIP-seq
MIRT1163432	hsa-miR-556-3p	CLIP-seq
MIRT1163433	hsa-miR-579	CLIP-seq
MIRT1163434	hsa-miR-608	CLIP-seq
MIRT1163435	hsa-miR-614	CLIP-seq
MIRT1163436	hsa-miR-622	CLIP-seq
MIRT1163437	hsa-miR-625	CLIP-seq
MIRT1163438	hsa-miR-637	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT1163441	hsa-miR-665	CLIP-seq
MIRT1163442	hsa-miR-671-5p	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT1163445	hsa-miR-767-3p	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163297	hsa-miR-1207-3p	CLIP-seq
MIRT2046896	hsa-miR-1207-5p	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT2046897	hsa-miR-1254	CLIP-seq
MIRT1163305	hsa-miR-1266	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT2046898	hsa-miR-1287	CLIP-seq
MIRT2046899	hsa-miR-1291	CLIP-seq
MIRT2046900	hsa-miR-1293	CLIP-seq
MIRT1163312	hsa-miR-1297	CLIP-seq
MIRT2046901	hsa-miR-1343	CLIP-seq
MIRT2046902	hsa-miR-138	CLIP-seq
MIRT2046903	hsa-miR-148a	CLIP-seq
MIRT2046904	hsa-miR-148b	CLIP-seq
MIRT2046905	hsa-miR-149	CLIP-seq
MIRT2046906	hsa-miR-152	CLIP-seq
MIRT2046907	hsa-miR-15a	CLIP-seq
MIRT2046908	hsa-miR-15b	CLIP-seq
MIRT2046909	hsa-miR-16	CLIP-seq
MIRT2046910	hsa-miR-1825	CLIP-seq
MIRT2046911	hsa-miR-184	CLIP-seq
MIRT1163314	hsa-miR-185	CLIP-seq
MIRT2046912	hsa-miR-1910	CLIP-seq
MIRT2046913	hsa-miR-1913	CLIP-seq
MIRT2046914	hsa-miR-195	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT2046916	hsa-miR-214	CLIP-seq
MIRT2046917	hsa-miR-22	CLIP-seq
MIRT2046918	hsa-miR-223	CLIP-seq
MIRT2046919	hsa-miR-2278	CLIP-seq
MIRT2046920	hsa-miR-24	CLIP-seq
MIRT1163320	hsa-miR-26a	CLIP-seq
MIRT1163321	hsa-miR-26b	CLIP-seq
MIRT1163322	hsa-miR-2861	CLIP-seq
MIRT2046921	hsa-miR-3064-3p	CLIP-seq
MIRT2046922	hsa-miR-3116	CLIP-seq
MIRT2046923	hsa-miR-3135b	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2046925	hsa-miR-3150a-5p	CLIP-seq
MIRT2046926	hsa-miR-3150b-5p	CLIP-seq
MIRT1163327	hsa-miR-3158-3p	CLIP-seq
MIRT2046927	hsa-miR-3189-5p	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT2046928	hsa-miR-3202	CLIP-seq
MIRT2046929	hsa-miR-324-3p	CLIP-seq
MIRT1163338	hsa-miR-326	CLIP-seq
MIRT1163339	hsa-miR-330-5p	CLIP-seq
MIRT2046930	hsa-miR-34a	CLIP-seq
MIRT2046931	hsa-miR-34c-5p	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT2046932	hsa-miR-3619-5p	CLIP-seq
MIRT2046933	hsa-miR-3622b-5p	CLIP-seq
MIRT2046934	hsa-miR-365	CLIP-seq
MIRT2046935	hsa-miR-3925-3p	CLIP-seq
MIRT1163348	hsa-miR-3934	CLIP-seq
MIRT1163349	hsa-miR-3944-5p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2046937	hsa-miR-424	CLIP-seq
MIRT2046938	hsa-miR-4258	CLIP-seq
MIRT1163353	hsa-miR-4259	CLIP-seq
MIRT2046939	hsa-miR-4267	CLIP-seq
MIRT2046940	hsa-miR-4277	CLIP-seq
MIRT2046941	hsa-miR-4290	CLIP-seq
MIRT1163359	hsa-miR-4306	CLIP-seq
MIRT2046942	hsa-miR-4307	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2046943	hsa-miR-4428	CLIP-seq
MIRT2046944	hsa-miR-4437	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT1163373	hsa-miR-4465	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2046945	hsa-miR-4483	CLIP-seq
MIRT2046946	hsa-miR-4487	CLIP-seq
MIRT2046947	hsa-miR-449a	CLIP-seq
MIRT2046948	hsa-miR-449b	CLIP-seq
MIRT2046949	hsa-miR-4514	CLIP-seq
MIRT1163380	hsa-miR-4518	CLIP-seq
MIRT2046950	hsa-miR-4530	CLIP-seq
MIRT1163383	hsa-miR-4532	CLIP-seq
MIRT2046951	hsa-miR-4638-3p	CLIP-seq
MIRT1163388	hsa-miR-4641	CLIP-seq
MIRT1163389	hsa-miR-4644	CLIP-seq
MIRT1163391	hsa-miR-4651	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT2046952	hsa-miR-4653-3p	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT2046953	hsa-miR-4676-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT2046954	hsa-miR-4688	CLIP-seq
MIRT2046955	hsa-miR-4690-5p	CLIP-seq
MIRT2046956	hsa-miR-4692	CLIP-seq
MIRT2046957	hsa-miR-4693-3p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT2046958	hsa-miR-4713-5p	CLIP-seq
MIRT1163407	hsa-miR-4715-5p	CLIP-seq
MIRT2046959	hsa-miR-4717-5p	CLIP-seq
MIRT2046960	hsa-miR-4721	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046962	hsa-miR-4728-5p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2046964	hsa-miR-4747-5p	CLIP-seq
MIRT2046965	hsa-miR-4749-3p	CLIP-seq
MIRT1163411	hsa-miR-4755-3p	CLIP-seq
MIRT2046966	hsa-miR-4758-3p	CLIP-seq
MIRT2046967	hsa-miR-4763-3p	CLIP-seq
MIRT2046968	hsa-miR-4765	CLIP-seq
MIRT1163413	hsa-miR-4769-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046971	hsa-miR-4804-5p	CLIP-seq
MIRT2046972	hsa-miR-483-3p	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046974	hsa-miR-485-5p	CLIP-seq
MIRT1163420	hsa-miR-486-3p	CLIP-seq
MIRT2046975	hsa-miR-497	CLIP-seq
MIRT2046976	hsa-miR-508-5p	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT2046978	hsa-miR-515-3p	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT2046982	hsa-miR-519e	CLIP-seq
MIRT1163429	hsa-miR-548q	CLIP-seq
MIRT2046983	hsa-miR-575	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163434	hsa-miR-608	CLIP-seq
MIRT2046985	hsa-miR-646	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT2046986	hsa-miR-744	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046987	hsa-miR-760	CLIP-seq
MIRT2046988	hsa-miR-761	CLIP-seq
MIRT2046989	hsa-miR-766	CLIP-seq
MIRT2046990	hsa-miR-875-3p	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT2276002	hsa-miR-1236	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT2046897	hsa-miR-1254	CLIP-seq
MIRT1163305	hsa-miR-1266	CLIP-seq
MIRT1163306	hsa-miR-1275	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT2046900	hsa-miR-1293	CLIP-seq
MIRT1163312	hsa-miR-1297	CLIP-seq
MIRT2046905	hsa-miR-149	CLIP-seq
MIRT2046907	hsa-miR-15a	CLIP-seq
MIRT2046908	hsa-miR-15b	CLIP-seq
MIRT2046909	hsa-miR-16	CLIP-seq
MIRT2046912	hsa-miR-1910	CLIP-seq
MIRT2046913	hsa-miR-1913	CLIP-seq
MIRT2276003	hsa-miR-1915	CLIP-seq
MIRT2046914	hsa-miR-195	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT1163318	hsa-miR-200b	CLIP-seq
MIRT1163319	hsa-miR-200c	CLIP-seq
MIRT2046916	hsa-miR-214	CLIP-seq
MIRT2046917	hsa-miR-22	CLIP-seq
MIRT2046920	hsa-miR-24	CLIP-seq
MIRT1163320	hsa-miR-26a	CLIP-seq
MIRT1163321	hsa-miR-26b	CLIP-seq
MIRT2276004	hsa-miR-28-5p	CLIP-seq
MIRT2046922	hsa-miR-3116	CLIP-seq
MIRT2276005	hsa-miR-3120-3p	CLIP-seq
MIRT2276006	hsa-miR-3139	CLIP-seq
MIRT1163326	hsa-miR-3148	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT1163327	hsa-miR-3158-3p	CLIP-seq
MIRT1163330	hsa-miR-3176	CLIP-seq
MIRT2046927	hsa-miR-3189-5p	CLIP-seq
MIRT2276007	hsa-miR-3199	CLIP-seq
MIRT2046929	hsa-miR-324-3p	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT2046932	hsa-miR-3619-5p	CLIP-seq
MIRT2276008	hsa-miR-3664-5p	CLIP-seq
MIRT2276009	hsa-miR-3667-3p	CLIP-seq
MIRT2276010	hsa-miR-3690	CLIP-seq
MIRT2276011	hsa-miR-374c	CLIP-seq
MIRT1163347	hsa-miR-3922-3p	CLIP-seq
MIRT2276012	hsa-miR-3942-3p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2046937	hsa-miR-424	CLIP-seq
MIRT2276013	hsa-miR-4254	CLIP-seq
MIRT2046938	hsa-miR-4258	CLIP-seq
MIRT1163353	hsa-miR-4259	CLIP-seq
MIRT1163356	hsa-miR-429	CLIP-seq
MIRT2276014	hsa-miR-4297	CLIP-seq
MIRT2276015	hsa-miR-4312	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2276016	hsa-miR-4426	CLIP-seq
MIRT2046943	hsa-miR-4428	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT2276017	hsa-miR-4457	CLIP-seq
MIRT1163373	hsa-miR-4465	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2046945	hsa-miR-4483	CLIP-seq
MIRT1163380	hsa-miR-4518	CLIP-seq
MIRT1163383	hsa-miR-4532	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT2276018	hsa-miR-4645-5p	CLIP-seq
MIRT2276019	hsa-miR-4647	CLIP-seq
MIRT2276020	hsa-miR-4662b	CLIP-seq
MIRT2276021	hsa-miR-4667-3p	CLIP-seq
MIRT2276022	hsa-miR-4673	CLIP-seq
MIRT2046953	hsa-miR-4676-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT2046958	hsa-miR-4713-5p	CLIP-seq
MIRT1163407	hsa-miR-4715-5p	CLIP-seq
MIRT2046960	hsa-miR-4721	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2276023	hsa-miR-4742-5p	CLIP-seq
MIRT1163411	hsa-miR-4755-3p	CLIP-seq
MIRT2046966	hsa-miR-4758-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046974	hsa-miR-485-5p	CLIP-seq
MIRT2046975	hsa-miR-497	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT2276024	hsa-miR-516a-3p	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT1163432	hsa-miR-556-3p	CLIP-seq
MIRT2276025	hsa-miR-558	CLIP-seq
MIRT2046983	hsa-miR-575	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT2276026	hsa-miR-655	CLIP-seq
MIRT2276027	hsa-miR-659	CLIP-seq
MIRT1163441	hsa-miR-665	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT2276028	hsa-miR-708	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046987	hsa-miR-760	CLIP-seq
MIRT2046988	hsa-miR-761	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT2276029	hsa-miR-935	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT2391153	hsa-miR-3156-5p	CLIP-seq
MIRT2391154	hsa-miR-3185	CLIP-seq
MIRT2276007	hsa-miR-3199	CLIP-seq
MIRT2391155	hsa-miR-3688-5p	CLIP-seq
MIRT2391156	hsa-miR-421	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT2391157	hsa-miR-4328	CLIP-seq
MIRT1163368	hsa-miR-4435	CLIP-seq
MIRT2391158	hsa-miR-450a	CLIP-seq
MIRT2391159	hsa-miR-4709-5p	CLIP-seq
MIRT2276024	hsa-miR-516a-3p	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT2391160	hsa-miR-644	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046979	hsa-miR-519a	CLIP-seq
MIRT2046980	hsa-miR-519b-3p	CLIP-seq
MIRT2046981	hsa-miR-519c-3p	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2574865	hsa-let-7a	CLIP-seq
MIRT2574866	hsa-let-7b	CLIP-seq
MIRT2574867	hsa-let-7c	CLIP-seq
MIRT2574868	hsa-let-7d	CLIP-seq
MIRT2574869	hsa-let-7e	CLIP-seq
MIRT2574870	hsa-let-7f	CLIP-seq
MIRT2574871	hsa-let-7g	CLIP-seq
MIRT2574872	hsa-let-7i	CLIP-seq
MIRT1163290	hsa-miR-103a	CLIP-seq
MIRT1163291	hsa-miR-103b	CLIP-seq
MIRT1163292	hsa-miR-107	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163295	hsa-miR-1200	CLIP-seq
MIRT2046896	hsa-miR-1207-5p	CLIP-seq
MIRT2574873	hsa-miR-1225-3p	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT2574874	hsa-miR-1253	CLIP-seq
MIRT2574875	hsa-miR-1270	CLIP-seq
MIRT2574876	hsa-miR-1273f	CLIP-seq
MIRT2574877	hsa-miR-127-3p	CLIP-seq
MIRT1163307	hsa-miR-1279	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT1163311	hsa-miR-129-3p	CLIP-seq
MIRT2574878	hsa-miR-1294	CLIP-seq
MIRT2574879	hsa-miR-129-5p	CLIP-seq
MIRT2574880	hsa-miR-1303	CLIP-seq
MIRT2574881	hsa-miR-142-3p	CLIP-seq
MIRT2574882	hsa-miR-143	CLIP-seq
MIRT2574883	hsa-miR-1539	CLIP-seq
MIRT1163314	hsa-miR-185	CLIP-seq
MIRT2574884	hsa-miR-186	CLIP-seq
MIRT2574885	hsa-miR-1911	CLIP-seq
MIRT2276003	hsa-miR-1915	CLIP-seq
MIRT2574886	hsa-miR-193a-3p	CLIP-seq
MIRT2574887	hsa-miR-193b	CLIP-seq
MIRT2574888	hsa-miR-196a	CLIP-seq
MIRT2574889	hsa-miR-196b	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT2574890	hsa-miR-202	CLIP-seq
MIRT2574891	hsa-miR-2052	CLIP-seq
MIRT2046916	hsa-miR-214	CLIP-seq
MIRT2574892	hsa-miR-217	CLIP-seq
MIRT2046920	hsa-miR-24	CLIP-seq
MIRT1163322	hsa-miR-2861	CLIP-seq
MIRT2046921	hsa-miR-3064-3p	CLIP-seq
MIRT2574893	hsa-miR-3117-5p	CLIP-seq
MIRT2276005	hsa-miR-3120-3p	CLIP-seq
MIRT2574894	hsa-miR-3123	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2574895	hsa-miR-3152-5p	CLIP-seq
MIRT2391153	hsa-miR-3156-5p	CLIP-seq
MIRT2574896	hsa-miR-3161	CLIP-seq
MIRT1163329	hsa-miR-3175	CLIP-seq
MIRT2574897	hsa-miR-3177-3p	CLIP-seq
MIRT1163332	hsa-miR-3183	CLIP-seq
MIRT2391154	hsa-miR-3185	CLIP-seq
MIRT2046927	hsa-miR-3189-5p	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT2574898	hsa-miR-3192	CLIP-seq
MIRT2574899	hsa-miR-3193	CLIP-seq
MIRT1163335	hsa-miR-3194-3p	CLIP-seq
MIRT1163340	hsa-miR-339-3p	CLIP-seq
MIRT2574900	hsa-miR-3613-3p	CLIP-seq
MIRT2046932	hsa-miR-3619-5p	CLIP-seq
MIRT2574901	hsa-miR-3622a-3p	CLIP-seq
MIRT2574902	hsa-miR-3622b-3p	CLIP-seq
MIRT1163343	hsa-miR-3651	CLIP-seq
MIRT2574903	hsa-miR-3657	CLIP-seq
MIRT2574904	hsa-miR-3662	CLIP-seq
MIRT2276008	hsa-miR-3664-5p	CLIP-seq
MIRT2574905	hsa-miR-3665	CLIP-seq
MIRT2574906	hsa-miR-3672	CLIP-seq
MIRT2574907	hsa-miR-3676	CLIP-seq
MIRT2574908	hsa-miR-3691-3p	CLIP-seq
MIRT2574909	hsa-miR-3921	CLIP-seq
MIRT2574910	hsa-miR-3925-5p	CLIP-seq
MIRT2276012	hsa-miR-3942-3p	CLIP-seq
MIRT2574911	hsa-miR-3943	CLIP-seq
MIRT1163349	hsa-miR-3944-5p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2391156	hsa-miR-421	CLIP-seq
MIRT1163352	hsa-miR-425	CLIP-seq
MIRT2574912	hsa-miR-4263	CLIP-seq
MIRT2046939	hsa-miR-4267	CLIP-seq
MIRT2574913	hsa-miR-4269	CLIP-seq
MIRT2574914	hsa-miR-4271	CLIP-seq
MIRT1163354	hsa-miR-4274	CLIP-seq
MIRT2574915	hsa-miR-4283	CLIP-seq
MIRT2574916	hsa-miR-4284	CLIP-seq
MIRT2574917	hsa-miR-4291	CLIP-seq
MIRT1163358	hsa-miR-4299	CLIP-seq
MIRT1163359	hsa-miR-4306	CLIP-seq
MIRT1163361	hsa-miR-4313	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163363	hsa-miR-4324	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2574918	hsa-miR-4420	CLIP-seq
MIRT2046944	hsa-miR-4437	CLIP-seq
MIRT2574919	hsa-miR-4438	CLIP-seq
MIRT1163371	hsa-miR-4456	CLIP-seq
MIRT2574920	hsa-miR-4458	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT1163375	hsa-miR-4469	CLIP-seq
MIRT1163378	hsa-miR-4494	CLIP-seq
MIRT2574921	hsa-miR-4500	CLIP-seq
MIRT1163379	hsa-miR-4512	CLIP-seq
MIRT1163381	hsa-miR-4519	CLIP-seq
MIRT2574922	hsa-miR-451b	CLIP-seq
MIRT1163382	hsa-miR-4522	CLIP-seq
MIRT2046950	hsa-miR-4530	CLIP-seq
MIRT2574923	hsa-miR-4531	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT1163387	hsa-miR-4640-3p	CLIP-seq
MIRT1163388	hsa-miR-4641	CLIP-seq
MIRT2574924	hsa-miR-4643	CLIP-seq
MIRT1163389	hsa-miR-4644	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT2574925	hsa-miR-4653-5p	CLIP-seq
MIRT1163394	hsa-miR-4659a-5p	CLIP-seq
MIRT1163395	hsa-miR-4659b-5p	CLIP-seq
MIRT2574926	hsa-miR-4661-5p	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT2574927	hsa-miR-4682	CLIP-seq
MIRT1163399	hsa-miR-4687-5p	CLIP-seq
MIRT2574928	hsa-miR-4699-5p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT1163403	hsa-miR-4704-5p	CLIP-seq
MIRT2574929	hsa-miR-4708-5p	CLIP-seq
MIRT2574930	hsa-miR-4709-3p	CLIP-seq
MIRT2391159	hsa-miR-4709-5p	CLIP-seq
MIRT2574931	hsa-miR-4710	CLIP-seq
MIRT1163405	hsa-miR-4714-3p	CLIP-seq
MIRT1163406	hsa-miR-4715-3p	CLIP-seq
MIRT2574932	hsa-miR-4716-3p	CLIP-seq
MIRT1163408	hsa-miR-4723-3p	CLIP-seq
MIRT2574933	hsa-miR-4725-3p	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2574934	hsa-miR-4736	CLIP-seq
MIRT2046966	hsa-miR-4758-3p	CLIP-seq
MIRT2046967	hsa-miR-4763-3p	CLIP-seq
MIRT2574935	hsa-miR-4770	CLIP-seq
MIRT2574936	hsa-miR-4774-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT1163415	hsa-miR-4776-3p	CLIP-seq
MIRT1163417	hsa-miR-4786-3p	CLIP-seq
MIRT1163418	hsa-miR-4787-5p	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT1163419	hsa-miR-4802-5p	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2574937	hsa-miR-486-5p	CLIP-seq
MIRT1163421	hsa-miR-499a-5p	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT2574938	hsa-miR-5095	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT1163427	hsa-miR-544b	CLIP-seq
MIRT1163429	hsa-miR-548q	CLIP-seq
MIRT1163433	hsa-miR-579	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT2574939	hsa-miR-620	CLIP-seq
MIRT1163436	hsa-miR-622	CLIP-seq
MIRT1163437	hsa-miR-625	CLIP-seq
MIRT1163438	hsa-miR-637	CLIP-seq
MIRT1163440	hsa-miR-661	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046988	hsa-miR-761	CLIP-seq
MIRT1163445	hsa-miR-767-3p	CLIP-seq
MIRT1163446	hsa-miR-885-3p	CLIP-seq
MIRT2574940	hsa-miR-892b	CLIP-seq
MIRT2574941	hsa-miR-922	CLIP-seq
MIRT2276029	hsa-miR-935	CLIP-seq
MIRT2574942	hsa-miR-938	CLIP-seq
MIRT2574943	hsa-miR-941	CLIP-seq
MIRT2574944	hsa-miR-98	CLIP-seq
MIRT2574865	hsa-let-7a	CLIP-seq
MIRT2574866	hsa-let-7b	CLIP-seq
MIRT2574867	hsa-let-7c	CLIP-seq
MIRT2574868	hsa-let-7d	CLIP-seq
MIRT2574869	hsa-let-7e	CLIP-seq
MIRT2574870	hsa-let-7f	CLIP-seq
MIRT2574871	hsa-let-7g	CLIP-seq
MIRT2574872	hsa-let-7i	CLIP-seq
MIRT1163293	hsa-miR-1184	CLIP-seq
MIRT1163294	hsa-miR-1197	CLIP-seq
MIRT2046896	hsa-miR-1207-5p	CLIP-seq
MIRT1163299	hsa-miR-1227	CLIP-seq
MIRT1163302	hsa-miR-1252	CLIP-seq
MIRT1163309	hsa-miR-1289	CLIP-seq
MIRT2574878	hsa-miR-1294	CLIP-seq
MIRT2685481	hsa-miR-1301	CLIP-seq
MIRT2685482	hsa-miR-134	CLIP-seq
MIRT2574881	hsa-miR-142-3p	CLIP-seq
MIRT2046905	hsa-miR-149	CLIP-seq
MIRT2276003	hsa-miR-1915	CLIP-seq
MIRT2574886	hsa-miR-193a-3p	CLIP-seq
MIRT2574887	hsa-miR-193b	CLIP-seq
MIRT2574888	hsa-miR-196a	CLIP-seq
MIRT2574889	hsa-miR-196b	CLIP-seq
MIRT2046915	hsa-miR-197	CLIP-seq
MIRT2574890	hsa-miR-202	CLIP-seq
MIRT2574891	hsa-miR-2052	CLIP-seq
MIRT2574892	hsa-miR-217	CLIP-seq
MIRT2046921	hsa-miR-3064-3p	CLIP-seq
MIRT2574893	hsa-miR-3117-5p	CLIP-seq
MIRT2685483	hsa-miR-3118	CLIP-seq
MIRT1163325	hsa-miR-3144-5p	CLIP-seq
MIRT2046924	hsa-miR-3149	CLIP-seq
MIRT2574895	hsa-miR-3152-5p	CLIP-seq
MIRT2391153	hsa-miR-3156-5p	CLIP-seq
MIRT2574896	hsa-miR-3161	CLIP-seq
MIRT2685484	hsa-miR-3164	CLIP-seq
MIRT2574897	hsa-miR-3177-3p	CLIP-seq
MIRT2391154	hsa-miR-3185	CLIP-seq
MIRT1163334	hsa-miR-3191	CLIP-seq
MIRT2574898	hsa-miR-3192	CLIP-seq
MIRT1163342	hsa-miR-3612	CLIP-seq
MIRT2574900	hsa-miR-3613-3p	CLIP-seq
MIRT2574901	hsa-miR-3622a-3p	CLIP-seq
MIRT2574902	hsa-miR-3622b-3p	CLIP-seq
MIRT2574903	hsa-miR-3657	CLIP-seq
MIRT2574904	hsa-miR-3662	CLIP-seq
MIRT2276008	hsa-miR-3664-5p	CLIP-seq
MIRT2574905	hsa-miR-3665	CLIP-seq
MIRT2574906	hsa-miR-3672	CLIP-seq
MIRT2574907	hsa-miR-3676	CLIP-seq
MIRT2574908	hsa-miR-3691-3p	CLIP-seq
MIRT2685485	hsa-miR-371-5p	CLIP-seq
MIRT2276012	hsa-miR-3942-3p	CLIP-seq
MIRT2046936	hsa-miR-411	CLIP-seq
MIRT2391156	hsa-miR-421	CLIP-seq
MIRT1163352	hsa-miR-425	CLIP-seq
MIRT2574914	hsa-miR-4271	CLIP-seq
MIRT1163354	hsa-miR-4274	CLIP-seq
MIRT1163362	hsa-miR-4323	CLIP-seq
MIRT1163365	hsa-miR-4418	CLIP-seq
MIRT2574918	hsa-miR-4420	CLIP-seq
MIRT2046944	hsa-miR-4437	CLIP-seq
MIRT2574919	hsa-miR-4438	CLIP-seq
MIRT1163369	hsa-miR-4443	CLIP-seq
MIRT2574920	hsa-miR-4458	CLIP-seq
MIRT1163374	hsa-miR-4466	CLIP-seq
MIRT2574921	hsa-miR-4500	CLIP-seq
MIRT2574922	hsa-miR-451b	CLIP-seq
MIRT1163385	hsa-miR-4635	CLIP-seq
MIRT1163386	hsa-miR-4639-3p	CLIP-seq
MIRT1163392	hsa-miR-4652-5p	CLIP-seq
MIRT2685486	hsa-miR-4660	CLIP-seq
MIRT1163396	hsa-miR-4667-5p	CLIP-seq
MIRT1163398	hsa-miR-4685-5p	CLIP-seq
MIRT1163402	hsa-miR-4700-5p	CLIP-seq
MIRT2391159	hsa-miR-4709-5p	CLIP-seq
MIRT2574931	hsa-miR-4710	CLIP-seq
MIRT1163405	hsa-miR-4714-3p	CLIP-seq
MIRT1163406	hsa-miR-4715-3p	CLIP-seq
MIRT2574932	hsa-miR-4716-3p	CLIP-seq
MIRT2574933	hsa-miR-4725-3p	CLIP-seq
MIRT2046961	hsa-miR-4726-3p	CLIP-seq
MIRT2046963	hsa-miR-4735-5p	CLIP-seq
MIRT2574934	hsa-miR-4736	CLIP-seq
MIRT2046967	hsa-miR-4763-3p	CLIP-seq
MIRT2574936	hsa-miR-4774-3p	CLIP-seq
MIRT2046969	hsa-miR-4775	CLIP-seq
MIRT1163417	hsa-miR-4786-3p	CLIP-seq
MIRT2046970	hsa-miR-4794	CLIP-seq
MIRT2046973	hsa-miR-483-5p	CLIP-seq
MIRT2046974	hsa-miR-485-5p	CLIP-seq
MIRT2574937	hsa-miR-486-5p	CLIP-seq
MIRT2685487	hsa-miR-5047	CLIP-seq
MIRT1163422	hsa-miR-509-3-5p	CLIP-seq
MIRT2574938	hsa-miR-5095	CLIP-seq
MIRT1163423	hsa-miR-509-5p	CLIP-seq
MIRT2046977	hsa-miR-5096	CLIP-seq
MIRT1163424	hsa-miR-516b	CLIP-seq
MIRT2046984	hsa-miR-590-3p	CLIP-seq
MIRT1163436	hsa-miR-622	CLIP-seq
MIRT1163437	hsa-miR-625	CLIP-seq
MIRT1163438	hsa-miR-637	CLIP-seq
MIRT1163439	hsa-miR-650	CLIP-seq
MIRT1163443	hsa-miR-675	CLIP-seq
MIRT1163444	hsa-miR-759	CLIP-seq
MIRT2046987	hsa-miR-760	CLIP-seq
MIRT2574940	hsa-miR-892b	CLIP-seq
MIRT2574942	hsa-miR-938	CLIP-seq
MIRT2574943	hsa-miR-941	CLIP-seq
MIRT2574944	hsa-miR-98	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NFE2L2	Activation	16551619

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001843	Process	Neural tube closure	IMP	25855017, 29222906
GO:0001843	Process	Neural tube closure	NAS	9349452
GO:0003824	Function	Catalytic activity	IEA
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IBA
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IDA	12673793, 24769206, 29891918
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IEA
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IGI	10551815
GO:0004489	Function	Methylenetetrahydrofolate reductase [NAD(P)H] activity	IMP	12673793, 25736335
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006555	Process	Methionine metabolic process	IEA
GO:0006555	Process	Methionine metabolic process	IGI	10551815
GO:0009086	Process	Methionine biosynthetic process	IBA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0033274	Process	Response to vitamin B2	IEA
GO:0035999	Process	Tetrahydrofolate interconversion	IBA
GO:0035999	Process	Tetrahydrofolate interconversion	IDA	12673793, 29891918
GO:0035999	Process	Tetrahydrofolate interconversion	IEA
GO:0035999	Process	Tetrahydrofolate interconversion	IGI	10551815
GO:0035999	Process	Tetrahydrofolate interconversion	IMP	12673793, 25736335
GO:0043200	Process	Response to amino acid	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	24769206
GO:0046500	Process	S-adenosylmethionine metabolic process	IEA
GO:0046653	Process	Tetrahydrofolate metabolic process	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IDA	12673793
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0050661	Function	NADP binding	IEA
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0050667	Process	Homocysteine metabolic process	IEA
GO:0051593	Process	Response to folic acid	IEA
GO:0070555	Process	Response to interleukin-1	IEA
GO:0070828	Process	Heterochromatin organization	IDA	24769206
GO:0071949	Function	FAD binding	IBA
GO:0072341	Function	Modified amino acid binding	IDA	20031578
GO:0106313	Function	Methylenetetrahydrofolate reductase (NADPH) activity	IEA

MIM	HGNC	e!Ensembl
607093	7436	ENSG00000177000

P42898

Protein name

Methylenetetrahydrofolate reductase (NADPH) (EC 1.5.1.53)

Protein function

Catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a cosubstrate for homocysteine remethylation to methionine (PubMed:29891918). Represents a key regulatory connection between the folate and methionine cycles

PDB

6FCX , 8QA4 , 8QA5 , 8QA6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02219	MTHFR	48 → 337	Methylenetetrahydrofolate reductase	Domain

Sequence

MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDPERHERLREKMRRRLESGDKWF
SLEFFPPRTAEGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAVNYC
GLETILHMTCCRQRLEEITGHLHKAKQLGLKNIMALRGDPIGDQWEEEEGGFNYAVDLVK
HIRSEFGDYFDICVAGYPKGHPEAGSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFV
KACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQEIKDVIEPIKDNDAAIRNYGIE
LAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWALSAHPKRREE
DVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKM
WGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGIL
TINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHL
VNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIERWGKLYE
EESPSRTIIQYIHDNYFLVNLVDNDFPLDNCLWQVVEDTLELLNRPTQNARETEAP

Sequence length

656

Interactions

View interactions

	KEGG		Reactome
	One carbon pool by folate Metabolic pathways Antifolate resistance Folate transport and metabolism		Metabolism of folate and pterines

166

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (17)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormality of metabolism/homeostasis	Pathogenic	rs121434294	RCV001813944	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Bilateral tonic-clonic seizure	Pathogenic	rs763186690	RCV001261544	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Clear cell carcinoma of kidney	Likely pathogenic	rs1057519359	RCV005893802	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cancer of breast	Likely pathogenic; Pathogenic	rs748397580	RCV005909223	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Generalized cerebral atrophy/hypoplasia	Likely pathogenic	rs1644256586	RCV001281375	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioma susceptibility 1	Pathogenic	rs986604359	RCV005900094	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Pathogenic	rs763186690	RCV001261544	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Homocystinuria due to methylene tetrahydrofolate reductase deficiency	Likely pathogenic; Pathogenic	rs1297161027, rs1644354028, rs760161369, rs1644092513, rs199476142, rs756018487, rs747668376, rs1263501260, rs2100527918, rs763539350, rs2100577466, rs545086633, rs786204034, rs147257424, rs2100507511 View all (117 more)	RCV001324137 RCV001336892 RCV001353257 RCV001377363 RCV001377365 RCV001385434 RCV001386742 RCV001380179 RCV001385897 RCV001380126 RCV001382595 RCV001420163 RCV001808247 RCV001838859 RCV001994550 RCV001999849 RCV001999864 RCV001946672 RCV001953816 RCV001995318 RCV001864382 RCV001939988 RCV001993395 RCV002042950 RCV001941557 RCV001963017 RCV002035641 RCV001934845 RCV001985134 RCV001985163 RCV002247150 RCV001209716 RCV001382824 RCV002225067 RCV001851626 RCV002512718 RCV000167626 RCV000167625 RCV000167624 RCV000167623 RCV000167621 RCV000167620 RCV000167619 RCV000167618 RCV000167617 RCV000167615 RCV000167614 RCV000167613 RCV000167612 RCV000167611 RCV000167610 RCV000167607 RCV000167605 RCV000167602 RCV000167600 RCV000167599 RCV000167597 RCV000167596 RCV000167595 RCV000167594 RCV000167592 RCV000167591 RCV000167589 RCV000167588 RCV000167587 RCV003093571 RCV002588344 RCV002630048 RCV002510619 RCV002627735 RCV002720888 RCV002851368 RCV002908322 RCV003017557 RCV003026952 RCV003048912 RCV003045095 RCV000416933 RCV000416797 RCV000416691 RCV000416935 RCV000416674 RCV005608927 RCV003153089 RCV003389932 RCV003523191 RCV003523192 RCV003523193 RCV004577963 RCV003523265 RCV003525253 RCV003525254 RCV003523641 RCV003523459 RCV003523665 RCV003524450 RCV003524706 RCV003636097 RCV003637720 RCV003637937 RCV003638062 RCV003635465 RCV003635548 RCV003635507 RCV003635493 RCV003635426 RCV003636670 RCV003636755 RCV003865098 RCV004515786 RCV005100913 RCV000546103 RCV000538018 RCV002532693 RCV000625779 RCV000625848 RCV003387441 RCV000690846 RCV000702419 RCV000721980 RCV000817838 RCV000791536 RCV000810485 RCV000813708 RCV000985005 RCV001236475 RCV001052871 RCV001055526 RCV001055646 RCV001052251 RCV001065420 RCV001244294 RCV001253140 RCV003770337 RCV001260224 RCV001377364 RCV005606799 RCV001290317 RCV001386292 RCV001300805	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Infantile spasms	Pathogenic	rs763186690	RCV001261544	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MTHFR-related disorder	Likely pathogenic	rs754015864	RCV004731535	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neural tube defect	Pathogenic	rs786204030	RCV000709684	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neural tube defects, folate-sensitive	Likely pathogenic; Pathogenic	rs1297161027, rs760161369, rs1644092513, rs199476142, rs763539350, rs545086633, rs2100568604, rs779993607, rs2100495241, rs1182635980, rs116620395, rs121434295, rs121434297, rs768434408, rs777661576 View all (66 more)	RCV005012774 RCV004570861 RCV003462949 RCV003462950 RCV003462963 RCV003463041 RCV003471132 RCV004571709 RCV003464183 RCV003471099 RCV004572080 RCV002476918 RCV003466798 RCV004567355 RCV003462251 RCV003468817 RCV003468816 RCV002492678 RCV003462250 RCV003462249 RCV003462248 RCV003468813 RCV004567354 RCV003462247 RCV003462246 RCV003468812 RCV003459753 RCV003465778 RCV003465902 RCV005008150 RCV003470259 RCV003470260 RCV003470261 RCV003461960 RCV003461961 RCV003461962 RCV003461963 RCV003470262 RCV003461964 RCV003461965 RCV003461966 RCV003470263 RCV003461967 RCV003461968 RCV003461969 RCV003470264 RCV003461970 RCV003470265 RCV003461971 RCV003461972 RCV003470266 RCV003461973 RCV003461974 RCV003461975 RCV003461976 RCV003461977 RCV004574156 RCV004573161 RCV004576268 RCV004576269 RCV004576270 RCV004576271 RCV004576272 RCV004576273 RCV004576275 RCV004576276 RCV003470753 RCV004568822 RCV003465361 RCV002477553 RCV003461249 RCV003461066 RCV003461196 RCV003461217 RCV003461295 RCV000986238 RCV002505603 RCV003469468 RCV003462834 RCV003462838 RCV003469502 RCV003462851 RCV003462865	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rare genetic intellectual disability	Likely pathogenic; Pathogenic	rs1434449406	RCV001257010	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Schizophrenia	Likely pathogenic; Pathogenic	rs1297161027, rs545086633, rs121434295, rs121434297, rs749765738, rs367585605, rs763539350, rs1057519359, rs754980119, rs140277700, rs750323424, rs748571395, rs764338697, rs767890671	RCV005012774 RCV004796633 RCV002476918 RCV005007812 RCV002492678 RCV002498831 RCV005008085 RCV005008150 RCV002477553 RCV005012368 RCV005012348 RCV005012406 RCV002505603 RCV002499515	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Secondary microcephaly	Pathogenic	rs763186690	RCV001261544	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spasticity	Pathogenic	rs763186690	RCV001261544	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombophilia due to thrombin defect	Likely pathogenic; Pathogenic	rs1297161027, rs545086633, rs121434295, rs121434297, rs749765738, rs367585605, rs574132670, rs763539350, rs1057519359, rs754980119, rs140277700, rs750323424, rs748571395, rs764338697, rs767890671	RCV005012774 RCV004796633 RCV002476918 RCV005007812 RCV002492678 RCV002498831 RCV005419880 RCV005008085 RCV005008150 RCV002477553 RCV005012368 RCV005012348 RCV005012406 RCV002505603 RCV002499515	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (149)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SICKLE CELL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANENCEPHALY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGLE CLOSURE GLAUCOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APHTHOUS STOMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD COAGULATION DISORDERS, INHERITED	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID STENOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL DYSPLASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CLUBFOOT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY RESTENOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delayed speech and language development	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, POSTPARTUM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal stromal tumor	drug response; Benign; Likely benign; other	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT VS HOST DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOLOGIC DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOLOGICAL DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC VEIN THROMBOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC VENO-OCCLUSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERHOMOCYSTEINEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PREGNANCY-INDUCED	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lower limb spasticity	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, FOLLICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALNUTRITION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mendelian syndromes with cleft lip/palate	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENIERE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental deterioration	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
methotrexate response - Toxicity	drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROVASCULAR ANGINA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MTHFR THERMOLABILE POLYMORPHISM	drug response; Benign; Likely benign; other	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECT, FOLATE-SENSITIVE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS X-LINKED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFTING SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PORTAL VEIN THROMBOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC DISEASE OF MITRAL VALVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC MITRAL REGURGITATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia, susceptibility to	Benign; Likely benign; other	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL DYSPLASIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dementia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (534)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Abnormal Karyotype	Associate	31737664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Abnormalities Drug Induced	Associate	36619555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Abortion Habitual	Associate	12738509, 15821810, 24235948, 24484533, 26060483, 27525841, 28703660, 28819944, 29785531, 30680517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Abortion Spontaneous	Associate	11821094, 12623486, 23288205, 25153695, 27068821, 28488549, 28580572, 28703660, 29564022, 32021228, 33914208, 35232413, 36008980, 38057822	★★★★★ ★☆☆☆☆ Found in Text Mining only
Activated Protein C Resistance	Associate	16015408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Associate	27051002, 29245302, 32160861, 35721657	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Disease	Associate	15886665	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Febrile Encephalopathy	Associate	16906320	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Injury	Associate	22129510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	12115343, 24490800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Inhibit	25536611	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	25536611	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	16108833, 16985020, 18768511, 31740010	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma Islet Cell	Associate	21462086	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Associate	24108782, 34956401	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Insufficiency	Associate	19123462, 33923969	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Associate	19353223	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age Related Hearing Impairment 1	Associate	21385350	★★★★★ ★☆☆☆☆ Found in Text Mining only
Albuminuria	Associate	21943240	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Associate	34752683	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	10860300, 15201366, 17691219, 18628954, 24223459, 24679048, 28342207, 32804129, 33833133	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease 6	Associate	14603192	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amaurosis Fugax	Associate	16015408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amputation Congenital	Associate	35450383	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Associate	19094231	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Megaloblastic	Associate	17908667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Associate	10583261, 11279637, 15224376, 16906320, 22084413, 23869056, 32201547, 37260067, 37895268, 9723576, 9840906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Associate	22377705, 26217949, 27068821	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Associate	10957660, 15996600	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm Ascending Aorta	Associate	19580662	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Associate	34348647, 38238653	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Associate	17895510, 23162020, 31173496	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antithrombin deficiency type 2	Associate	10029588	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Associate	10957660, 15996600, 26017485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Familial Abdominal 1	Associate	10957660, 26017485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Familial Thoracic 1	Associate	26017485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Coarctation	Associate	19764075	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrest of spermatogenesis	Associate	28440964	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Poisoning	Associate	31864032, 37929396	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Associate	10360908, 18293456, 32201547	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Associate	27234992, 37355582	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	11710708, 15361376, 16272757, 16439441, 16572443, 17213520, 17965559, 18195462, 19571519, 19578646, 19625220, 20423475, 22377704, 23547211, 24447348 View all (7 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	27692391	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy progressive pseudorheumatoid of childhood	Associate	16305696	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenia	Associate	33035787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	25591454, 34511169, 36592167	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asymptomatic Diseases	Associate	32525932	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	19148342, 19403988, 19934557, 20423475, 20433440, 21394321, 26828698, 26915609, 28086795, 29444504, 35680906, 36806868, 36876682	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Associate	17551576, 28390428	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrioventricular Septal Defect	Associate	20718043	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Associate	31929371, 32758174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Associate	21618410, 21897766, 23227261, 34573389, 36655641, 37285328	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Associate	19267885, 22648721, 36655641	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Associate	19267885, 33411826	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Associate	34752683	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Associate	28440964	★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith Wiedemann Syndrome	Associate	30165906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Associate	14521457, 16299146, 22180713, 22773907, 24136464, 31173496	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bell Palsy	Associate	29327764	★★★★★ ★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Associate	31173496	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	27187171	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Associate	22176285, 22370993, 25101272, 25744938	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Birth Weight	Associate	35631247	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bjornstad syndrome	Associate	35631247	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Associate	17442092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Associate	12361206, 15678268, 29115087	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Associate	31015243	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Associate	12674333, 22377704, 32549258, 37816983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Associate	25264227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases Metabolic Inborn	Associate	17976958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Associate	20191019	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Associate	29264982	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Associate	32264844	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	12473175, 12602921, 15004488, 15736423, 16097444, 17069650, 17595805, 18669903, 18708404, 18842997, 19123462, 19389261, 19706843, 19707223, 19759169 View all (31 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Inhibit	22373582, 34242313	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Stimulate	29544444	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Budd Chiari Syndrome	Associate	12221667, 22180713	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary Malformation Arteriovenous Malformation	Associate	37933013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	12060127, 16108833, 20130515, 21180947, 22218157, 23275280, 24966971, 26745044, 27976555, 34242313, 34502300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	21672255	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	17503006, 17659576, 19035314, 25318605, 25337902, 31694048, 34502300, 34644732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	16334126, 23463763, 24063603, 25104092, 29186089	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	26191297	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	21342495	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Associate	23244112	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	10027946, 11532106, 15073633, 15735067, 15750260, 15996600, 17622358, 17976958, 18672474, 18840629, 19267198, 21270364, 21613384, 22237773, 22277556 View all (20 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Associate	20134102, 32404177, 32675800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Associate	11781870, 18160591, 19353312, 29439641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Associate	37121723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract Age Related Nuclear	Associate	26689687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Associate	19248194, 21688148	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Arterial Diseases	Associate	31725629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Associate	25144711, 37898918	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	10572079, 10929044, 11870335, 15946211, 16624841, 16679643, 16936384, 17461517, 18560453, 18672474, 18796459, 19934557, 19934565, 21678004, 22203923 View all (31 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Inhibit	30781868	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Stimulate	36193932	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Intraventricular Hemorrhage	Associate	23896193, 28578513	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Associate	22098125	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Associate	26839351, 35307828	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Associate	11307798, 3177384	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	12453860, 17488658, 33752528	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	17201138	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholelithiasis	Associate	32228104	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choline Deficiency	Associate	27342765	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chorea Gravidarum	Associate	24014470	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroidal Effusions	Associate	31566926	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Associate	30796269	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome Aberrations	Associate	22377705, 27068821, 36008980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Associate	18661527, 18797703, 21781437, 28230599, 31663447, 36655641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Associate	18661527, 21781437, 27167580, 30578914, 31122291, 31663447, 36901988	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	10486408, 19013496, 21358708, 25625218, 25882604, 32325916, 32497019, 34045473, 35307828, 37462970	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Associate	25625218, 37462970	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Associate	18700049	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	10446107, 31173496, 37816983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	11889073, 12107847, 16177213, 21603981	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Associate	11781870, 11889073, 12427779, 15161007, 15447919, 15546509, 16103455, 16177213, 16638790, 16819711, 16866026, 16886608, 17036383, 17449906, 17465256 View all (54 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Stimulate	18992148, 18996879, 20447924	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	19156174, 37914736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Associate	26990189, 28580572, 37933013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	14527888	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Plasminogen Deficiency	Associate	10629572	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Associate	19493349, 20031554, 20111745, 22495907, 30165839	★★★★★ ★☆☆☆☆ Found in Text Mining only
Constipation	Associate	20551579, 23098510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Constriction Pathologic	Associate	23274712	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Endothelial Cell Loss	Associate	17491230, 26137654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	10212171, 10929044, 14521457, 15447919, 16612468, 16802358, 17264399, 17622358, 18403793, 18586656, 18751630, 1998339, 20530057, 20962453, 21769819 View all (15 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Dissection Spontaneous	Associate	11872884	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	15121769, 16274479, 17591934, 18622257, 23288205, 24218123, 27051002, 29245302, 32675800, 9708460	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Associate	10929044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Associate	17000887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronavirus Infections	Associate	34061414	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	33254541, 34061414, 35415903, 36647888, 36980916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coxa Magna	Associate	18350352	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Associate	18387654, 39769114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	10446107, 28002332	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cushing's symphalangism	Associate	23274712, 24846872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Daneman Davy Mancer syndrome	Associate	34644732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness Neural Congenital Moderate	Associate	10929044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	22524826, 22524840, 22605962, 22799365, 25840420, 26277606, 27916838, 32264844, 36102491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Associate	10860300, 11781870	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	20096138, 21125200, 21635773, 22739363, 26926881, 27626182, 31185929, 33263678, 33315905, 35904038, 37628752, 39769114	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Associate	20504979, 39769114	★★★★★ ★☆☆☆☆ Found in Text Mining only
dhat syndrome	Associate	39213757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Associate	16274479	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	35334827, 35631247, 37106323, 37818092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Inhibit	35334827	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	10090925, 11531629, 15836661, 20134102, 22880024, 23391848, 24218123, 27976555, 29534533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Insulin Dependent 19	Associate	25700330, 28765644	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	11531629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	15836661, 16274479, 19934557, 20134102, 22554825, 24452036, 25165408, 25537992, 27983710, 28231061, 28409162, 29694640, 33455465, 34289004, 35057543	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Inhibit	35057543	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Associate	16906320, 27990443	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Foot	Associate	26579581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	22554825, 30729677	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Associate	23901246, 24452036	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	23901246, 24452036, 32860770	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Associate	19672255, 22045187, 26970343	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disease	Associate	27449989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection Blood Vessel	Associate	11872884, 16844951	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection Thoracic Aorta	Associate	35305471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Associate	34204335	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	10930360, 11443546, 15585767, 15834031, 16845273, 18057532, 18257130, 18273817, 19096127, 20592453, 20868477, 21045269, 22377700, 24668664, 26017139, 33440639, 33608632, 35060496 View all (3 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Stimulate	16845273	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Drug Related Side Effects and Adverse Reactions	Associate	11418485, 15361376, 16272757, 17009228, 17213520, 17488658, 19159907, 19384296, 19465420, 20819423, 21887680, 22045187, 23681825, 26142939, 26928923 View all (4 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Stimulate	21887680	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Associate	34521653	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Associate	34126931	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Associate	26337056, 26442927, 30786773, 34289004, 34498771, 38287840	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly cardiopathy dysmorphism	Associate	36421790	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectromelia	Associate	21281325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolic Stroke	Associate	28963520	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolism Fat	Associate	32019154	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryo Loss	Associate	10958762	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis Herpes Simplex	Associate	25302494	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	23299529	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Associate	35788150, 37895084	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	12027572, 17561949, 17904392, 21543238, 22425007, 25915064, 26142939, 27976555, 30442198, 35904038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Associate	17904392	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	19058336, 21672255, 22292644, 22430803, 22524840, 23803097, 33322951, 36102491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	16333305, 21375764, 21672255, 22524840, 22853296, 23244153, 24393513, 27323028, 28046029, 33819921	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Associate	25041994, 25337902	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Associate	15750260, 16081343, 26442927, 29436860, 32555714, 35284002, 36845669	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Associate	16636653, 23687437	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial antiphospholipid syndrome	Associate	12027572, 23771968	★★★★★ ★☆☆☆☆ Found in Text Mining only
Farber Lipogranulomatosis	Associate	24083702, 27976555, 31066758, 38634541	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue	Associate	23975093, 29186089	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	21854603, 23547829, 24488901	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fetal Death	Associate	19909951	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Diseases	Associate	11781870, 18160599, 19520681, 24014470	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	12097536, 29564022, 40674756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Stimulate	30313110	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Membranes Premature Rupture	Associate	37106323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	21854603, 23547829, 31929371	★★★★★ ★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Associate	10583261, 12623486, 12958073, 15051606, 18612269, 22277790, 22424391, 22515117, 23936521, 26266420, 26561410, 27187171, 27725412, 28094233, 28963520 View all (7 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Inhibit	34502300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Associate	11781870, 14704292, 22901194, 37933013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Inhibit	28045918	★★★★★ ★☆☆☆☆ Found in Text Mining only
Foramen Ovale Patent	Associate	32512924	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fractures Bone	Associate	12674333, 17174622, 17725378	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Associate	33462011	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Associate	19267198, 32758174, 37327296	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Associate	19648163, 25104092	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Associate	33322951	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Associate	26375922	★★★★★ ★☆☆☆☆ Found in Text Mining only
Genetic Diseases Inborn	Associate	10929044, 27321094	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Associate	23687437, 25054348, 27585654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma 3 Primary Congenital A	Associate	27585654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Associate	18385801, 19936026, 27824919	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Associate	16636653, 18385801, 19936026, 25054348, 27585654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	18497326, 24301776, 32264844	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	16821630, 18483342, 24301776, 28820331	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Associate	31929371	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Associate	21500982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease 0 Muscle	Associate	11279637	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Associate	21613384	★★★★★ ★☆☆☆☆ Found in Text Mining only
Goiter Multinodular 2	Associate	34644732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Associate	16920564, 21920473	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hallucinations	Associate	31401974	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Associate	27976555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hand Foot Syndrome	Associate	23736036, 31601265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	22430803, 23276522	★★★★★ ★☆☆☆☆ Found in Text Mining only
Headache	Associate	30170616	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Associate	21385350, 22424391	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Functional	Associate	34847989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Associate	22424391	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Associate	15951337, 16305696, 20031554, 21254360, 22197386, 25494855, 25846410, 26035828, 26990189, 28230599, 28758112, 29793361, 33219830, 33440639, 34126931, 36421790, 36655641, 38287462 View all (3 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	26654251, 35499926, 36845669, 37898918, 40562371	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Associate	32512924, 38287462	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Atrial	Associate	19764075, 34126931, 36421790	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Associate	20031554, 28758112, 34126931, 35870951, 36421790, 36759823	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Associate	26813460	★★★★★ ★☆☆☆☆ Found in Text Mining only
Helicobacter Infections	Associate	23183616, 24615072, 38579505	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Associate	19159907, 19764075, 25041994, 36794870, 37633908	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemoglobin SC Disease	Associate	16906320	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Associate	19448163	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Associate	19959486, 22098125, 30819996	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Associate	22203923	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Associate	30830849	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Associate	34644732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Associate	21854603	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	17595805, 22669161, 27237471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Associate	30273369	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Associate	26314858	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	16538645	★★★★★ ★☆☆☆☆ Found in Text Mining only
Homocysteinemia	Associate	16011963, 16679643, 17449548, 17561949, 18796459, 19125845, 19846961, 22628232, 23869894, 24506394, 25380613, 3177384, 33254541, 9350916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Homocystinuria	Associate	23866722, 32347013, 33057012, 39322052, 7726158, 9490685	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Associate	16372906, 36902304	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Associate	16184507	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Associate	23975093	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia Neonatal	Associate	23936521	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Associate	26442927	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Associate	29264982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Associate	10323785, 10958762, 11169021, 11279637, 11531629, 11781870, 12221667, 14603192, 14717963, 15051606, 15114606, 15226189, 15497528, 15612980, 15750260 View all (88 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Inhibit	17976958, 29428336	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemias	Associate	11870335, 23865383	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Associate	20065615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Associate	23534584	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Associate	36845669	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	12797595, 18654952, 18855261, 19013496, 19330901, 20592457, 21270364, 22237773, 22277556, 22676332, 22897803, 23188888, 24189452, 24459043, 24959828 View all (35 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pregnancy Induced	Stimulate	32720760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pregnancy Induced	Associate	32720760, 37106323, 40674756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Associate	16274479, 16906320, 23901246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Associate	31066758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Associate	26337056, 30786773	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Associate	36845669	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Associate	23534584	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Associate	15082892, 32278343, 38287840	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	16299146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Associate	40674756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension Orthostatic	Associate	22504314	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Associate	31066758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	22117975	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	15361376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ige Responsiveness Atopic	Associate	36592167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iliac Aneurysm	Associate	33462011	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Associate	12436152, 23936521	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infant Newborn Diseases	Associate	23162020, 25829992	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction	Associate	23975911	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction Anterior Cerebral Artery	Associate	40562371	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	38579505	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inferior Wall Myocardial Infarction	Associate	36876682	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Associate	18930220, 19324355, 19657388, 24737513, 25283235, 31173496, 32399796, 33914208, 36008980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Female	Associate	19324355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Associate	21085488, 21857689, 22457816, 22692281, 24737513, 27232852, 28270024, 28842818, 33786731, 36655641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	19332210, 29396861, 32019154, 34752683	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	10446107, 16249980, 16262529, 28002332, 37816983	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Associate	17976958, 24488901, 29658358, 31200713	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Associate	32758174, 37327296	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Associate	23460600	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriosclerosis	Associate	36197177	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Associate	17456624, 21500982, 29168367, 31025572, 37076800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Associate	11307798, 32347013, 34241942	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Associate	31725629, 37204128	★★★★★ ★☆☆☆☆ Found in Text Mining only
Job Syndrome	Associate	10446107, 17561949, 18855261	★★★★★ ★☆☆☆☆ Found in Text Mining only
Joint Diseases	Associate	31566926	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	11532106, 16274479, 16760910, 21613384, 22897803, 26717388, 38238653	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Associate	11532106, 16557227, 19520684, 24785111, 9264011	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	21613384	★★★★★ ★☆☆☆☆ Found in Text Mining only
Klinefelter Syndrome	Associate	18160591	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	23838799	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngitis	Associate	26535623	★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Associate	39769114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Legg Calve Perthes Disease	Associate	35264229	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	10029588, 11274424, 12453860, 12958073, 18339682, 20101025, 21873357, 22377705, 25793509, 26438060, 33930029	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Eosinophilic Acute	Associate	29916259	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	11781870	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	26438060	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	24966971, 25510667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	10536004, 11274424, 20101025, 26438060, 28374953	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Associate	9054653	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoaraiosis	Associate	27583843	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathies	Associate	18806228, 25829992, 30362058, 33148145, 33833133, 37527941	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Associate	19648163, 26970343, 29186089	★★★★★ ★☆☆☆☆ Found in Text Mining only
Livedoid Vasculopathy	Associate	17442092, 23901246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Associate	16570355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	17503006, 26137554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure Acute	Associate	27783703	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Associate	21128869	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	22052259	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	16334126, 20065319, 21342495, 22024018, 22144047, 22938410, 23372658, 24175756, 25536611, 25921104, 28236470, 34325549	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Associate	12027572, 15934123, 16802358, 19625220, 31173496, 35507987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lyme Disease	Associate	26862099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	23244112, 31523170	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	11342450, 14535593, 15551285, 15921520, 16886608, 21504712, 23174714, 37527941	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Inhibit	15551285	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma B Cell Marginal Zone	Associate	28779180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Associate	15198953, 16410450	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	14535593, 15198953, 18288132, 21504712, 23174714	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	15198953, 17119116, 17488658, 23174714, 28779180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Inhibit	17119116, 18042267	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Associate	16538645	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Associate	30796269	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malaria	Associate	27198213	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	16821630, 18483342, 30583664, 34169999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Inhibit	30583664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Associate	18937358, 23227261, 27384413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	30633186, 31401974, 36014826, 36655641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesenteric Ischemia	Associate	19846322	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesenteric Vascular Occlusion	Associate	11133719, 36655641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Associate	18523009, 19225123, 25318605	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	17491230, 17976958, 19267885, 20724652, 22370993, 22690662, 22832733, 25429430, 25432492, 27321094, 29658358, 34371949, 36806868	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolism Inborn Errors	Associate	36655641, 9490685	★★★★★ ★☆☆☆☆ Found in Text Mining only
Methylcobalamin Deficiency CblG Type	Associate	18842997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Methylenetetrahydrofolate reductase deficiency	Inhibit	10551815	★★★★★ ★☆☆☆☆ Found in Text Mining only
Methylenetetrahydrofolate reductase deficiency	Associate	1998340, 33290257, 36655641, 38238653, 7726158, 8940272	★★★★★ ★☆☆☆☆ Found in Text Mining only
Methylmalonic Aciduria and Homocystinuria CblF Type	Associate	8903338	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microsatellite Instability	Associate	20193847	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Associate	17491230	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Associate	15053827, 18672474, 19384265, 19673907, 21635773, 23430981, 23915182, 23975093, 27976555, 30170616	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Associate	15053827, 18672474, 19673907, 21635773, 23230240, 23430981, 23915182, 30170616	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Inhibit	19673907	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine without Aura	Associate	23915182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Insufficiency	Associate	26813460	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	21920473	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	16080493, 26749456	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Associate	17488658, 22045187, 34614057	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Associate	19854238, 24412677, 25625218, 31038186, 32355262	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Relapsing Remitting	Associate	24412677	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Disorders Atrophic	Associate	37327296	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Associate	27999265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycobacterium Infections	Associate	27686649	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycobacterium Infections Nontuberculous	Associate	27686649	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	27449989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	10090925, 11303694, 12615788, 14717963, 22750768, 23171482, 23274712, 36279151, 36876682	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Associate	24452036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Associate	29534533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nausea	Associate	29186089	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Associate	34169999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm Metastasis	Associate	17925917, 26046315	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11274424, 12107847, 14716779, 15161007, 16177213, 16272757, 16532039, 16538645, 16821630, 16985020, 17036383, 17069650, 17488658, 17533396, 17591934 View all (54 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	12060127, 34502300	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	23803051, 27916838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Associate	17976958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	21672255, 28353639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes Hereditary	Associate	21500982, 30633186	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Associate	21613384	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nerve Compression Syndromes	Associate	23975093	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Associate	10090889, 10551815, 10958762, 11274424, 11781870, 12384833, 12594357, 15060097, 15921520, 17035141, 19178434, 19803295, 20031554, 20589617, 22903727 View all (18 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Associate	32295184	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Associate	21618410	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	19421414, 25054348, 27380243, 27585654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibroma	Associate	27976555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Associate	27976555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Associate	27976555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	23749819, 39769114, 7726158	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurotoxicity Syndromes	Associate	19031955, 21064136	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Associate	28747156, 29186089	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non alcoholic Fatty Liver Disease	Associate	23547829, 24488901, 26031974, 28507283	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Associate	22424391	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	20664391, 25432492, 25612568, 25846410, 27322299, 27793164, 27983710, 29694640, 31671528, 32019154, 33455465, 37106323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Associate	29658358	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oguchi disease	Associate	22665972	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Associate	24301776	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Associate	21085488, 22457816, 28440964, 31127676	★★★★★ ★☆☆☆☆ Found in Text Mining only
Opioid Related Disorders	Associate	35328943	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Nerve Diseases	Associate	23771968	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Associate	27976555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Associate	18796459, 23401650	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Associate	16299146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Associate	21254359, 27167580, 38219184	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	23089924	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Associate	18350352, 20229089, 9840906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Associate	17174622, 22377704, 24014470, 29534533, 39310265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporotic Fractures	Associate	17174622, 17725378, 29534533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	19159907, 27837635	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	30922641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Associate	16009185, 30922641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	16011963, 20817226, 22524826, 22605962, 37628752, 9099956	★★★★★ ★☆☆☆☆ Found in Text Mining only
Overweight	Associate	27322299, 27793164, 27983710, 29925788, 31671528, 32019154, 37106323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	24895587, 27473058, 29474406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Associate	23468971	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillomavirus Infections	Associate	24474455	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis	Associate	30544400	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	17691219, 25909872, 27613114	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal ventricular fibrillation	Associate	27759448	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Associate	22098125	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Associate	16274479, 32633259, 7647779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Associate	23468971, 23901246, 28231061, 37522679	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Associate	21394321	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Associate	29465562	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phlebitis	Associate	17000887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Photophobia	Associate	23915182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	17454207, 27321094, 28081274, 31482954, 33407572	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyostotic osteolytic dysplasia hereditary expansile	Associate	26314858	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Associate	37112866	★★★★★ ★☆☆☆☆ Found in Text Mining only
Postoperative Nausea and Vomiting	Associate	26970343	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	15059157, 24611473, 26214484, 27755385, 29564022, 32720760, 9192280	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Inhibit	27755385	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	21672255, 32758174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10029588, 10536004, 11274424, 11986237, 12958073, 16886608, 17970089, 20002681, 20071789, 21873357, 24476575, 26438060, 27409003, 29390492, 31443485, 31499477, 31737664 View all (2 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	11986237, 20002681	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11736945, 24476575, 36655641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Preeclamptic toxemia	Associate	10877984, 15059157	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Birth	Associate	11531629, 23936521, 29428336, 32720760, 34907829, 35631247, 35691911	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Birth	Inhibit	32720760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pressure Ulcer	Associate	22606049	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proctitis	Associate	18700049	★★★★★ ★☆☆☆☆ Found in Text Mining only
Propping Zerres syndrome	Associate	17970089	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	22296369, 23275280, 26107198, 27819322, 27916838	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatitis	Associate	27916838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Associate	10029588	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein S Deficiency	Associate	32347013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	Associate	36607854	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	30999684	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Associate	31401974, 39769114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Associate	12797595, 29027816	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Atresia	Associate	16305696	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Embolism	Associate	16432849, 18586684, 18800213, 19520679, 26987498, 27729560, 29916259, 33128086, 40453635	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Valve Stenosis	Associate	16305696	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Associate	31015243	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Associate	16432849	★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation Pneumonitis	Associate	22144047, 28046029	★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Associate	31651110	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	17245555, 20056627, 20920350, 21462086, 21603981, 21865946, 22045187, 22218157, 23098510, 25041994	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Artery Obstruction	Associate	23146986	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal cell carcinoma 1	Inhibit	3177384	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Associate	20433440, 23534584, 26247037, 29785531, 37005654, 37239884	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Associate	18405246, 22897803, 26579581	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Associate	33035787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Artery Occlusion	Associate	26862099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Associate	16015408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Associate	11122096, 11673296, 14527888, 19825913, 19825918, 24569626, 27221722, 31173043, 31831825, 32347013, 33370962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Associate	37511576	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Associate	26813460	★★★★★ ★☆☆☆☆ Found in Text Mining only
Riboflavin Deficiency	Associate	14704292, 36264281	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rumination Syndrome	Associate	26926881	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	17976958, 22370993, 25101272, 27932499, 31401974, 32347013, 32497019, 39769114	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Scleroderma Systemic	Associate	37239884	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Associate	12027572, 30442198, 35904038, 37491869	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensation Disorders	Associate	39769114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septate Uterus	Associate	32512924, 36421790	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis Intracranial	Associate	19703820, 23172871, 24923843	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	28779180, 31173496	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Associate	29421402	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Initiation and Maintenance Disorders	Associate	23975093, 34847989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Slowed Nerve Conduction Velocity Autosomal Dominant	Associate	37260067	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	17533396	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smoke Inhalation Injury	Associate	22024018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Injuries	Associate	36232908	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida Occulta	Associate	20066615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Associate	16361298	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Dysraphism	Associate	12180146, 17479212, 18937353, 19683694, 21204206, 24323870, 7564788, 9327028, 9863598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	17596206, 21180947, 21460376, 26535623, 26749456, 32079256	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	15244514, 16158971, 16886608, 17201138, 18231104, 20237899, 20504332, 23183616, 23534741, 23803092, 23934457, 24490800, 24615072, 24737431, 25337902 View all (6 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Associate	25041994, 27452984	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Associate	11307798, 14693836, 15497528, 16624841, 16782775, 16906320, 16936384, 17098841, 18560453, 21394321, 21678004, 22275392, 22594584, 23285280, 23547211 View all (15 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke Lacunar	Associate	26839351	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Associate	19826759	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	26749456, 33639682	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalamic Diseases	Associate	15497528	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Associate	30819996	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Associate	17000887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Associate	17488658, 25104092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Associate	10446107, 12469051, 16188774, 16379339, 17911197, 19715531, 23866722, 32347013, 9490685	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Associate	11426488, 11821094, 12555209, 15497023, 15678268, 15748240, 15821810, 15834246, 16015408, 16184507, 17456620, 18160589, 18160591, 18191809, 19520681 View all (31 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia hereditary	Associate	18840629, 19520681, 22750768, 24235948, 31173496, 36980916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	10029588, 10440914, 10929044, 11122096, 11426488, 12361206, 15114606, 15834246, 16080493, 16173969, 16679643, 17000887, 17456626, 17911197, 18796459 View all (28 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Associate	19448163	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombotic Stroke	Associate	23162020, 40691374	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Associate	27999265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Associate	15447919, 31066758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	29511243	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tooth Loss	Associate	17895510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Associate	28842818	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	25801246, 32497019, 34242313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trisomy 18 Syndrome	Associate	11443546	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Associate	22283972, 26217949	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcer	Associate	17000887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Associate	9264011	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urethral Neoplasms	Associate	29472622	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	22126575, 22747749, 28348449, 32340630, 40570095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Associate	32228104	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Diseases	Associate	23444906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	17303386, 20130515, 21897271, 24474455, 25302494	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Associate	24474455, 29740106, 31750632	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervicitis	Associate	23444906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Ulcer	Associate	21500982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Associate	26137554	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Associate	21394321	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	10323785, 10551815, 11169021, 11274424, 11279637, 11531629, 15053827, 15921520, 17449548, 18855261, 22594584, 23285280, 26137654, 26915609, 30557982 View all (5 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Malformations	Associate	31725629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Associate	17000887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Associate	26137554	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Associate	10029588, 15009459, 15886665, 19520679, 20229089, 21078611, 22628232, 23288205, 23866722, 26915609, 27686649, 29916259, 34325549, 40453635, 9217179, 9792287 View all (1 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Associate	10360908, 10929044, 11122096, 11781870, 15096570, 15114595, 16188774, 16379339, 16634748, 17442092, 17591934, 18293456, 18800213, 19353312, 22707612 View all (18 more)	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Stimulate	26261166	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Virus Diseases	Associate	23444906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Associate	31401974	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin B 12 Deficiency	Associate	16445837, 16988141, 17449548, 17908667, 19094231, 22470444, 26137654, 28094233, 37101129	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Associate	30720153	★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Diseases	Associate	19959486	★★★★★ ★☆☆☆☆ Found in Text Mining only
Weight Gain	Associate	27932499	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Associate	23749819	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthomatosis Cerebrotendinous	Associate	15612980	★★★★★ ★☆☆☆☆ Found in Text Mining only

MTHFR (methylenetetrahydrofolate reductase)